From 53b56012ef62b9f27623674cafa6d6fc121bfdea Mon Sep 17 00:00:00 2001 From: Lukas Stadler <lukas.stadler@oracle.com> Date: Tue, 3 Mar 2015 09:58:35 +0100 Subject: [PATCH] enable some more tests --- .../truffle/r/test/ExpectedTestOutput.test | 479 ++++++++++++++++++ .../oracle/truffle/r/test/all/AllTests.java | 2 +- .../truffle/r/test/failing/FailingTests.java | 420 --------------- .../r/test/library/base/TestConnections.java | 1 - .../library/base/TestSimpleDataFrames.java | 6 - .../test/library/base/TestSimpleVectors.java | 2 - .../test/testrgen/TestrGenBuiltinReduce.java | 29 +- .../TestrGenBuiltinallequalPOSIXt.java | 30 +- .../test/testrgen/TestrGenBuiltinappend.java | 18 +- .../testrgen/TestrGenBuiltinascomplex.java | 6 +- .../testrgen/TestrGenBuiltinasinteger.java | 6 +- .../testrgen/TestrGenBuiltinasvector.java | 2 - .../r/test/testrgen/TestrGenBuiltinatan2.java | 7 +- .../testrgen/TestrGenBuiltincharToRaw.java | 6 +- .../test/testrgen/TestrGenBuiltinexists.java | 18 +- ...iltinextract_parentasis_assign_factor.java | 19 +- ...asis_extract_parentasis_assign_factor.java | 19 +- .../r/test/testrgen/TestrGenBuiltingsub.java | 2 - .../testrgen/TestrGenBuiltiniscomplex.java | 1 - .../r/test/testrgen/TestrGenBuiltinisna.java | 1 - .../test/testrgen/TestrGenBuiltinisnull.java | 37 +- .../test/testrgen/TestrGenBuiltinlabels.java | 19 +- .../test/testrgen/TestrGenBuiltinmatrix.java | 1 - .../r/test/testrgen/TestrGenBuiltinmean.java | 1 - .../testrgen/TestrGenBuiltinoperators.java | 9 - .../TestrGenBuiltinprintfunction.java | 6 +- .../r/test/testrgen/TestrGenBuiltinsep.java | 1 - .../r/test/testrgen/TestrGenBuiltinsink.java | 6 +- .../testrgen/TestrGenBuiltinsinknumber.java | 6 +- .../r/test/testrgen/TestrGenBuiltinsplit.java | 4 - .../test/testrgen/TestrGenBuiltinsprintf.java | 27 +- .../testrgen/TestrGenBuiltinstrsplit.java | 1 - .../r/test/testrgen/TestrGenBuiltinsub.java | 7 +- .../test/testrgen/TestrGenBuiltinunique.java | 2 - .../testrgen/TestrGenBuiltinunitsassign_.java | 19 +- .../TestrGenBuiltinunitsassign_difftime.java | 19 +- .../test/testrgen/TestrGenBuiltinvector.java | 16 +- .../testrgen/TestrGenBuiltinwriteLines.java | 19 +- 38 files changed, 610 insertions(+), 664 deletions(-) diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/ExpectedTestOutput.test b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/ExpectedTestOutput.test index e2aa9b4da5..c15d4da3f4 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/ExpectedTestOutput.test +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/ExpectedTestOutput.test @@ -18064,6 +18064,11 @@ Levels: y z #{ x<-list(7,42); class(x)<-"data.frame"; row.names(x)<-"r1"; x[[1]] } [1] 7 +##com.oracle.truffle.r.test.library.base.TestSimpleDataFrames.testAsDataFrame +#{ x<-1; class(x)<-"foo"; y<-as.data.frame(x) } +Error in as.data.frame.default(x) : + cannot coerce class ""foo"" to a data.frame + ##com.oracle.truffle.r.test.library.base.TestSimpleDataFrames.testAsDataFrame #{ x<-as.character(c(7L,42L)); y<-as.data.frame(x, row.names=NULL, nm="x"); attributes(y); } $names @@ -57905,6 +57910,60 @@ Error in `[[.default`(x, "z", exact = TRUE) : subscript out of bounds #{ x<-factor(c("a", "b", "a")); .subset2(x, 1) } [1] 1 +##com.oracle.truffle.r.test.library.base.TestSimpleVectors.testObjectDirectAccess +#{ x<-factor(c("a", "b", "a")); `[.factor`(x, 1) } +[1] a +Levels: a b + +##com.oracle.truffle.r.test.library.base.TestSimpleVectors.testObjectDirectAccess +#{ x<-factor(c("a", "b", "a")); `[.factor`(x, 1, drop=FALSE) } +[1] a +Levels: a b + +##com.oracle.truffle.r.test.library.base.TestSimpleVectors.testObjectDirectAccess +#{ x<-factor(c("a", "b", "a")); `[.factor`(x, 1, drop=TRUE) } +[1] a +Levels: a + +##com.oracle.truffle.r.test.library.base.TestSimpleVectors.testObjectDirectAccess +#{ x<-factor(c("a", "b", "a")); `[[.factor`(x, 1) } +[1] a +Levels: a b + +##com.oracle.truffle.r.test.library.base.TestSimpleVectors.testObjectDirectAccess +#{ x<-factor(c("a", "b", "a")); `[[`(x, 1) } +[1] a +Levels: a b + +##com.oracle.truffle.r.test.library.base.TestSimpleVectors.testObjectDirectAccess +#{ x<-factor(c("a", "b", "a")); `[`(x, 1) } +[1] a +Levels: a b + +##com.oracle.truffle.r.test.library.base.TestSimpleVectors.testObjectDirectAccess +#{ x<-factor(c("a", "b", "a")); `[`(x, 1, drop=FALSE) } +[1] a +Levels: a b + +##com.oracle.truffle.r.test.library.base.TestSimpleVectors.testObjectDirectAccess +#{ x<-factor(c("a", z="b", "a")); `[[.factor`(x, "z") } +[1] b +Levels: a b + +##com.oracle.truffle.r.test.library.base.TestSimpleVectors.testObjectDirectAccess +#{ x<-factor(c("a", zz="b", "a")); `[[.factor`(x, "z", exact=FALSE) } +[1] b +Levels: a b + +##com.oracle.truffle.r.test.library.base.TestSimpleVectors.testObjectDirectAccess +#{ x<-factor(c("a", zz="b", "a")); `[[.factor`(x, "z", exact=TRUE) } +Error in `[[.default`(x, "z", exact = TRUE) : subscript out of bounds + +##com.oracle.truffle.r.test.library.base.TestSimpleVectors.testObjectDirectAccess +#{ x<-factor(c("a", zz="b", "a")); `[[`(x, "z", exact=FALSE) } +[1] b +Levels: a b + ##com.oracle.truffle.r.test.library.base.TestSimpleVectors.testPrint #{ mp<-getOption("max.print"); options(max.print=3); x<-c(1,2,3,4,5); attr(x, "foo")<-"foo"; print(x); options(max.print=mp) } [1] 1 2 3 @@ -63938,6 +63997,10 @@ $two [26] 0.0181818182 0.0129870130 0.0086580087 0.0051948052 0.0025974026 [31] 0.0008658009 +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinReduce.testReduce1 +#argv <- structure(list(f = '+', x = 1:7, accumulate = TRUE), .Names = c('f', 'x', 'accumulate'));do.call('Reduce', argv) +[1] 1 3 6 10 15 21 28 + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinSysgetenv.testSysgetenv2 #argv <- list('SWEAVE_OPTIONS', NA_character_); .Internal(Sys.getenv(argv[[1]], argv[[2]])) [1] NA @@ -64128,6 +64191,10 @@ numeric(0) #argv <- structure(list(target = 0.261799387799149, current = 6.54498469497874), .Names = c('target', 'current'));do.call('all.equal', argv) [1] "Mean relative difference: 24" +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinallequalPOSIXt.testallequalPOSIXt1 +#argv <- structure(list(target = structure(1412833061.16639, class = c('POSIXct', 'POSIXt')), current = structure(1412833061.16839, class = c('POSIXct', 'POSIXt'))), .Names = c('target', 'current'));do.call('all.equal.POSIXt', argv) +[1] "Mean absolute difference: 0.002000093" + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinallequalcharacter.testallequalcharacter1 #argv <- structure(list(target = structure(c('A', 'E', 'I', 'M', 'Q', 'U', 'B', 'F', 'J', 'N', 'R', 'V', 'C', 'G', 'K', 'O', 'S', 'W', 'D', 'H', 'L', 'P', 'T', 'X'), .Dim = c(6L, 4L)), current = structure(c('A', 'E', 'I', 'M', 'Q', 'U', 'B', 'F', 'J', 'N', 'R', 'V', 'C', 'G', 'K', 'O', 'S', 'W', 'D', 'H', 'L', 'P', 'T', 'X'), .Dim = c(6L, 4L))), .Names = c('target', 'current'));do.call('all.equal.character', argv) [1] TRUE @@ -64404,6 +64471,10 @@ numeric(0) [5,] -10 0 180 0 0 0 340 380 [6,] 0 0 0 0 0 0 0 0 +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinappend.testappend1 +#argv <- structure(list(x = 1:5, values = 0:1, after = 3), .Names = c('x', 'values', 'after'));do.call('append', argv) +[1] 1 2 3 0 1 4 5 + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinargs.testargs1 #argv <- list(NULL); .Internal(args(argv[[1]])) NULL @@ -65413,6 +65484,10 @@ complex(0) #argv <- list('1.3');as.complex(argv[[1]]); [1] 1.3+0i +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinascomplex.testascomplex7 +#argv <- list(NA_complex_);as.complex(argv[[1]]); +[1] NA + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinascomplex.testascomplex8 #argv <- list(integer(0));as.complex(argv[[1]]); complex(0) @@ -65648,6 +65723,10 @@ integer(0) #argv <- list(2e+05);as.integer(argv[[1]]); [1] 200000 +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinasinteger.testasinteger7 +#argv <- list(NULL);as.integer(argv[[1]]); +integer(0) + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinasinteger.testasinteger8 #argv <- list(list(7L, 20, 0L, 1));as.integer(argv[[1]]); [1] 7 20 0 1 @@ -65947,6 +66026,15 @@ $g2 #argv <- list(structure(1:12, .Dim = 3:4, .Dimnames = list(c('A', 'B', 'C'), c('D', 'E', 'F', 'G'))), 'any'); .Internal(as.vector(argv[[1]], argv[[2]])) [1] 1 2 3 4 5 6 7 8 9 10 11 12 +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinasvector.testasvector33 +#argv <- list(quote(list(cut(Dtimes, '3 months'))), 'list'); .Internal(as.vector(argv[[1]], argv[[2]])) +[[1]] +list + +[[2]] +cut(Dtimes, "3 months") + + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinasvector.testasvector35 #argv <- list(structure(list(a = 1), .Names = 'a'), 'double'); .Internal(as.vector(argv[[1]], argv[[2]])) [1] 1 @@ -66060,6 +66148,10 @@ $a4 #argv <- list(FALSE, 'character'); .Internal(as.vector(argv[[1]], argv[[2]])) [1] "FALSE" +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinasvector.testasvector76 +#argv <- list(structure(list(c0 = structure(character(0), class = 'AsIs')), .Names = 'c0', row.names = character(0), class = 'data.frame'), 'character'); .Internal(as.vector(argv[[1]], argv[[2]])) +[1] "character(0)" + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinasvector.testasvector77 #argv <- list(structure(list(), .Dim = 0L), 'any'); .Internal(as.vector(argv[[1]], argv[[2]])) list() @@ -66152,6 +66244,16 @@ diff #argv <- list(structure(numeric(0), .Dim = c(0L, 0L)));atan(argv[[1]]); <0 x 0 matrix> +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinatan2.testatan23 +#argv <- list(c(-1.95681154249341, -2.88854075894443, -2.84850921846233, -2.14635417317387, -1.72790445779804, -0.92649412488672, -0.261537463816701, 0.948205247045638, 1.0990096500205, 2.09024037060933, 2.90928417418961, 4.00425294069879, 1.70515935701163), c(-3.2406391957027, -2.61163262017643, -0.21977838696678, 1.24931893031091, 1.6032898858835, 2.16902716372255, 2.15792786802985, 2.10075226013806, 2.04989923648162, 1.49269068253165, 0.515893014329757, -2.61745072267338, -4.64929811590859)); .Internal(atan2(argv[[1]], argv[[2]])) + [1] -2.5983580 -2.3058916 -1.6477994 -1.0436683 -0.8227891 -0.4036880 + [7] -0.1206102 0.4239882 0.4921311 0.9506540 1.3952942 2.1497456 +[13] 2.7900689 + +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinatan2.testatan26 +#argv <- list(logical(0), logical(0)); .Internal(atan2(argv[[1]], argv[[2]])) +numeric(0) + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinattr.testattr1 #argv <- list(structure(c(1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 0, 1, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 0, 1, 1, 1, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 1, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 1, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 1, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 1, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 1, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 1, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 1, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 1, 1), .Dim = c(32L, 23L), .Dimnames = list(c('1', '2', '3', '4', '5', '6', '7', '8', '9', '10', '11', '12', '13', '14', '15', '16', '17', '18', '19', '20', '21', '22', '23', '24', '25', '26', '27', '28', '29', '30', '31', '32'), c('(Intercept)', 'HairBrown', 'HairRed', 'HairBlond', 'EyeBlue', 'EyeHazel', 'EyeGreen', 'SexFemale', 'HairBrown:EyeBlue', 'HairRed:EyeBlue', 'HairBlond:EyeBlue', 'HairBrown:EyeHazel', 'HairRed:EyeHazel', 'HairBlond:EyeHazel', 'HairBrown:EyeGreen', 'HairRed:EyeGreen', 'HairBlond:EyeGreen', 'HairBrown:SexFemale', 'HairRed:SexFemale', 'HairBlond:SexFemale', 'EyeBlue:SexFemale', 'EyeHazel:SexFemale', 'EyeGreen:SexFemale')), assign = c(0L, 1L, 1L, 1L, 2L, 2L, 2L, 3L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 5L, 5L, 5L, 6L, 6L, 6L), contrasts = structure(list(Hair = 'contr.treatment', Eye = 'contr.treatment', Sex = 'contr.treatment'), .Names = c('Hair', 'Eye', 'Sex'))), 'assign');attr(argv[[1]],argv[[2]]); [1] 0 1 1 1 2 2 2 3 4 4 4 4 4 4 4 4 4 5 5 5 6 6 6 @@ -67462,6 +67564,10 @@ head #argv <- list(c(-2, -1.5, -1, -0.5, 0, 0.5, 1, 1.5, 2, 2.5, 3, 3.5, 4));do.call('ceiling', argv) [1] -2 -1 -1 0 0 1 1 2 2 3 3 4 4 +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltincharToRaw.testcharToRaw1 +#argv <- list(''); .Internal(charToRaw(argv[[1]])) +raw(0) + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltincharacter.testcharacter1 #argv <- structure(list(length = 0L), .Names = 'length');do.call('character', argv) character(0) @@ -68583,6 +68689,10 @@ NULL #argv <- list(structure(numeric(0), .Dim = c(0L, 0L))); .Internal(environmentName(argv[[1]])) [1] "" +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinexists.testexists1 +#argv <- structure(list(x = '.Device'), .Names = 'x');do.call('exists', argv) +[1] TRUE + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinexp.testexp1 #argv <- list(-3.99290891786396);exp(argv[[1]]); [1] 0.01844598 @@ -68625,6 +68735,29 @@ NULL #argv <- list(structure(numeric(0), .Dim = c(0L, 0L)));expm1(argv[[1]]); <0 x 0 matrix> +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinextract_parentasis_assign_factor.testextract_parentasis_assign_factor1 +#argv <- structure(list(x = structure(c(4L, 1L, 4L, 4L, 6L, 4L, 5L, 5L, 4L, 6L, 6L, 2L, 3L, 6L, 4L, 2L, 1L, 6L, 1L, 3L, 3L, 5L, 2L, 2L, 2L, 5L, 3L, 3L, 1L, 2L, 5L, 6L, 6L, 6L, 6L, 2L, 6L, 1L, 5L, 1L, 2L, 4L, 4L, 6L, 5L, 5L, 2L, 6L, 4L, 6L, 5L, 1L, 2L, 5L, 1L, 1L, 4L, 3L, 3L, 4L, 4L, 2L, 5L, 3L, 4L, 5L, 4L, 6L, 4L, 5L, 2L, 6L, 2L, 4L, 2L, 2L, 4L, 4L, 1L, 6L, 2L, 1L, 5L, 3L, 5L, 1L, 2L, 2L, 4L, 2L, 4L, 2L, 5L, 6L, 5L, 6L, 3L, 1L, 2L, 4L, 6L, 6L, 3L, 3L, 2L, 6L, 2L, 5L, 3L, 4L, 3L, 4L, 6L, 3L, 4L, 2L, 3L, 1L, 6L, 2L, 4L, 4L, 1L, 3L, 4L, 3L, 4L, 1L, 4L, 1L, 3L, 5L, 5L, 5L, 4L, 4L, 6L, 2L, 6L, 3L, 2L, 1L, 1L, 6L, 2L, 2L, 5L, 1L, 5L, 3L, 2L, 2L, 5L, 1L, 6L, 3L, 6L, 4L, 2L, 2L, 5L, 6L, 6L, 1L, 1L, 6L, 6L, 5L, 2L, 5L, 6L, 5L, 4L, 6L, 2L, 5L, 4L, 3L, 5L, 1L, 3L, 4L, 4L, 3L, 1L, 1L, 5L, 4L, 1L, 3L, 5L, 4L, 5L, 4L, 6L, 6L, 2L, 4L, 3L, 3L), .Label = c('a', 'b', 'c', 'd', 'e', 'f'), class = 'factor'), c(189L, 84L, 154L, 9L, 130L, 44L, 137L, 12L, 50L, 1L, 42L, 174L, 194L, 131L, 157L, 101L, 37L, 128L, 117L, 181L, 51L, 109L, 110L, 67L, 69L, 124L, 192L, 65L, 171L, 168L), value = NA), .Names = c('x', '', 'value'));do.call('[<-.factor', argv) + [1] <NA> a d d f d e e <NA> f f <NA> c f d + [16] b a f a c c e b b b e c c a b + [31] e f f f f b <NA> a e a b <NA> d <NA> e + [46] e b f d <NA> <NA> a b e a a d c c d + [61] d b e c <NA> e <NA> f <NA> e b f b d b + [76] b d d a f b a e <NA> e a b b d b + [91] d b e f e f c a b d <NA> f c c b +[106] f b e <NA> <NA> c d f c d b <NA> a f b +[121] d d a <NA> d c d <NA> d <NA> <NA> e e e d +[136] d <NA> b f c b a a f b b e a e c +[151] b b e <NA> f c <NA> d b b e f f a a +[166] f f <NA> b e <NA> e d <NA> b e d c e a +[181] <NA> d d c a a e d <NA> c e <NA> e <NA> f +[196] f b d c c +Levels: a b c d e f + +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinextract_parentasis_extract_parentasis_assign_factor.testextract_parentasis_extract_parentasis_assign_factor1 +#argv <- structure(list(x = structure(c(2L, 2L, 3L), .Label = c('One', 'Two', 'Three'), class = 'factor'), 2, value = 'One'), .Names = c('x', '', 'value'));do.call('[[<-.factor', argv) +[1] Two One Three +Levels: One Two Three + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinfactor.testfactor1 #argv <- structure(list(x = c(1L, 0L, 1L, 1L, 1L, 1L, 1L, 1L, 0L, 0L, 0L, 0L, 1L, 1L, 0L, 1L, 0L, 1L, 1L, 1L, 0L, 1L, 0L, 0L, 1L, 1L, 0L, 0L, 1L, 1L, 0L, 0L, 0L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 1L, 1L, 1L, 1L, 0L, 0L, 0L, 1L, 1L, 0L, 1L, 1L, 1L, 0L, 1L, 0L, 1L, 1L, 0L, 1L, 1L, 1L, 1L, 1L, 0L, 0L, 1L, 0L, 1L, 1L, 1L, 0L, 0L, 0L, 1L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 0L, 1L, 0L, 1L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 1L, 0L, 1L, 0L, 1L, 1L, 1L, 0L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 0L, 0L, 1L, 0L, 0L, 0L, 0L, 1L, 1L, 1L, 0L, 0L, 0L, 0L, 0L, 0L, 1L, 1L, 0L, 1L, 1L, 1L, 0L, 0L, 1L, 1L, 1L, 0L, 0L, 1L, 1L, 1L, 1L, 0L, 1L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 1L, 1L, 0L, 1L, 0L, 0L, 0L, 1L, 1L, 0L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 0L, 1L, 0L, 0L, 1L, 1L, 1L, 0L, 1L, 0L, 0L, 1L, 1L, 1L, 0L, 1L, 1L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 1L, 0L, 1L, 0L, 0L, 1L, 0L, 0L, 1L, 0L, 1L, 1L, 0L, 1L, 1L, 0L, 1L, 0L, 1L, 0L, 1L, 0L, 0L, 1L, 1L, 1L, 0L, 1L, 1L, 1L, 1L, 1L, 0L, 0L, 1L, 0L, 1L, 0L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 1L, 1L, 0L, 1L, 0L, 1L, 0L, 1L, 0L, 1L, 1L, 1L, 1L, 0L, 0L, 1L, 0L, 0L, 1L, 0L, 1L, 1L, 1L, 1L, 1L, 1L, 0L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 0L, 1L, 0L, 0L, 0L, 0L, 0L, 1L, 1L, 0L, 0L, 0L, 0L, 1L, 1L, 0L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 0L, 0L, 0L, 0L, 1L, 1L, 1L, 0L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 1L, 0L, 1L, 1L, 1L, 0L, 1L, 1L, 0L, 1L, 1L, 0L, 1L, 1L, 1L, 0L, 1L, 1L, 0L, 1L, 1L, 1L, 1L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 0L, 1L, 1L, 1L, 0L, 0L, 1L, 0L, 1L, 1L, 1L, 1L, 1L, 0L, 0L, 1L, 1L, 1L, 1L, 1L, 0L, 1L, 1L, 1L, 1L, 0L, 0L, 1L, 1L, 1L, 1L, 0L, 0L, 0L, 1L, 1L, 1L, 1L, 0L, 1L, 1L, 0L, 0L, 0L, 1L, 1L, 1L, 0L, 0L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 0L, 1L, 0L, 0L, 1L, 0L, 1L, 1L, 1L, 1L, 0L, 1L, 1L, 0L, 1L, 0L, 1L, 0L, 0L, 1L, 1L, 1L, 0L, 1L, 0L, 0L, 1L, 0L, 0L, 1L, 1L, 1L, 0L, 0L, 0L, 0L, 0L, 1L, 0L, 0L, 1L, 1L, 1L, 1L, 1L, 0L, 0L, 0L, 1L, 1L, 0L, 1L, 0L, 0L, 1L, 1L, 0L, 1L, 0L, 1L, 1L, 1L, 1L, 0L, 0L, 0L, 0L, 1L, 1L, 0L, 1L, 0L, 0L, 0L, 1L, 1L, 0L, 1L, 0L, 0L, 0L, 0L, 0L, 1L, 0L, 1L, 0L, 1L, 1L, 0L, 1L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 1L, 1L, 1L, 1L, 0L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 0L, 0L, 0L, 1L, 1L, 1L, 1L, 0L, 0L, 0L, 0L, 1L, 1L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 1L, 0L, 1L, 0L, 1L, 1L, 1L, 0L, 1L, 1L, 1L, 0L, 0L, 1L, 0L, 1L, 0L, 1L, 1L, 0L, 0L, 0L, 0L, 1L, 0L, 1L, 0L, 0L, 1L, 0L, 0L, 1L, 1L, 0L, 1L, 1L, 0L, 0L, 0L, 1L, 0L, 1L, 0L, 1L, 0L, 0L, 1L, 0L, 0L, 0L, 0L, 0L, 1L, 1L, 1L, 1L, 1L, 0L, 1L, 0L, 0L, 1L, 1L, 0L, 0L, 1L, 1L, 0L, 0L, 0L, 0L, 0L, 1L, 1L, 1L, 0L, 1L, 1L, 1L, 1L, 0L, 0L, 1L, 0L, 0L, 1L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 1L, 1L, 1L, 0L, 1L, 1L, 1L, 1L, 1L, 0L, 1L, 0L, 0L, 1L, 1L, 0L, 0L, 0L, 0L, 0L, 0L, 1L, 0L, 0L, 1L, 0L, 1L, 0L, 0L, 1L, 1L, 0L, 0L, 1L, 1L, 1L, 0L, 0L, 0L, 0L, 1L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 1L, 1L, 0L, 0L, 1L, 0L, 1L, 0L, 1L, 0L, 1L, 0L, 1L, 1L, 1L, 0L, 0L, 1L, 0L, 1L, 1L, 0L, 1L, 1L, 0L, 1L, 1L, 0L, 0L, 0L, 1L, 1L, 1L, 1L, 0L, 0L, 0L, 1L, 1L, 0L, 0L, 0L, 0L, 1L, 1L, 1L, 1L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 1L, 0L, 1L, 1L, 0L, 0L, 0L, 1L, 1L, 0L, 0L, 1L, 0L, 0L, 1L, 0L, 0L, 1L, 0L, 1L, 0L, 0L, 0L, 1L, 1L, 0L, 1L, 0L, 0L, 0L, 0L, 0L, 0L, 1L, 1L, 0L, 1L, 0L, 0L, 1L, 1L, 0L, 1L, 0L, 1L, 0L, 1L, 1L, 1L, 0L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 0L, 1L, 1L, 0L, 1L, 0L, 0L, 0L, 1L, 1L, 1L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 1L, 0L, 1L, 0L, 1L, 1L, 1L, 1L, 0L, 1L, 1L, 1L, 1L, 1L, 0L, 1L, 0L, 1L, 1L, 0L, 0L, 1L, 0L, 1L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 1L, 1L, 0L, 1L, 1L, 1L, 1L, 0L, 0L, 1L, 1L, 1L, 0L, 0L, 1L, 0L, 0L, 1L, 0L, 1L, 0L, 1L, 0L, 1L, 1L, 0L, 0L, 1L, 0L, 0L, 1L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 1L, 1L, 0L, 0L, 0L, 0L, 0L, 1L, 1L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 1L, 0L, 1L, 1L, 0L, 0L, 1L, 0L, 0L, 1L, 1L, 0L, 1L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 0L, 1L, 1L, 0L, 1L, 0L, 0L, 1L, 1L, 0L, 1L, 1L, 0L, 1L, 1L, 1L, 1L, 1L, 0L, 1L, 1L, 1L, 0L, 1L, 0L, 1L, 1L, 0L, 1L, 0L, 1L)), .Names = 'x');do.call('factor', argv) [1] 1 0 1 1 1 1 1 1 0 0 0 0 1 1 0 1 0 1 1 1 0 1 0 0 1 1 0 0 1 1 0 0 0 0 0 0 1 @@ -69008,6 +69141,32 @@ character(0) #argv <- list('.__M__(.*):([^:]+)', '\\1', character(0), FALSE, FALSE, FALSE, FALSE); .Internal(gsub(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]])) character(0) +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltingsub.testgsub25 +#argv <- list('%', '\\\\%', structure('foo', .Names = 'object'), FALSE, FALSE, FALSE, FALSE); .Internal(gsub(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]])) +object + "foo" + +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltingsub.testgsub27 +#argv <- list('.__T__(.*):([^:]+(.*))', '\\2', c('.__T__!:base', '.__T__%%:base', '.__T__%*%:base', '.__T__%/%:base', '.__T__&:base', '.__T__*:base', '.__T__+:base', '.__T__-:base', '.__T__/:base', '.__T__Arith:base', '.__T__BunchKaufman:Matrix', '.__T__Cholesky:Matrix', '.__T__Compare:methods', '.__T__Logic:base', '.__T__Math2:methods', '.__T__Math:base', '.__T__Ops:base', '.__T__Schur:Matrix', '.__T__Summary:base', '.__T__[:base', '.__T__[<-:base', '.__T__^:base', '.__T__all.equal:base', '.__T__all:base', '.__T__any:base', '.__T__as.array:base', '.__T__as.integer:base', '.__T__as.logical:base', '.__T__as.matrix:base', '.__T__as.numeric:base', '.__T__as.vector:base', '.__T__band:Matrix', '.__T__cbind2:methods', '.__T__chol2inv:base', '.__T__chol:base', '.__T__coerce:methods', '.__T__coerce<-:methods', '.__T__colMeans:base', '.__T__colSums:base', '.__T__cov2cor:stats', '.__T__crossprod:base', '.__T__determinant:base', '.__T__diag:base', '.__T__diag<-:base', '.__T__diff:base', '.__T__dim:base', '.__T__dim<-:base', '.__T__dimnames:base', '.__T__dimnames<-:base', '.__T__drop:base', '.__T__expand:Matrix', '.__T__expm:Matrix', '.__T__facmul:Matrix', '.__T__forceSymmetric:Matrix', '.__T__format:base', '.__T__head:utils', '.__T__image:graphics', '.__T__initialize:methods', '.__T__is.finite:base', '.__T__is.infinite:base', '.__T__is.na:base', '.__T__isDiagonal:Matrix', '.__T__isSymmetric:base', '.__T__isTriangular:Matrix', '.__T__kronecker:base', '.__T__length:base', '.__T__lu:Matrix', '.__T__mean:base', '.__T__nnzero:Matrix', '.__T__norm:base', '.__T__pack:Matrix', '.__T__print:base', '.__T__prod:base', '.__T__qr.Q:base', '.__T__qr.R:base', '.__T__qr.coef:base', '.__T__qr.fitted:base', '.__T__qr.qty:base', '.__T__qr.qy:base', '.__T__qr.resid:base', '.__T__qr:base', '.__T__rbind2:methods', '.__T__rcond:base', '.__T__rep:base', '.__T__rowMeans:base', '.__T__rowSums:base', '.__T__show:methods', '.__T__skewpart:Matrix', '.__T__solve:base', '.__T__sum:base', '.__T__summary:base', '.__T__symmpart:Matrix', '.__T__t:base', '.__T__tail:utils', '.__T__tcrossprod:base', '.__T__toeplitz:stats', '.__T__tril:Matrix', '.__T__triu:Matrix', '.__T__unname:base', '.__T__unpack:Matrix', '.__T__update:stats', '.__T__updown:Matrix', '.__T__which:base', '.__T__writeMM:Matrix', '.__T__zapsmall:base'), FALSE, FALSE, FALSE, FALSE); .Internal(gsub(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]])) + [1] "base" "base" "base" "base" "base" "base" + [7] "base" "base" "base" "base" "Matrix" "Matrix" + [13] "methods" "base" "methods" "base" "base" "Matrix" + [19] "base" "base" "base" "base" "base" "base" + [25] "base" "base" "base" "base" "base" "base" + [31] "base" "Matrix" "methods" "base" "base" "methods" + [37] "methods" "base" "base" "stats" "base" "base" + [43] "base" "base" "base" "base" "base" "base" + [49] "base" "base" "Matrix" "Matrix" "Matrix" "Matrix" + [55] "base" "utils" "graphics" "methods" "base" "base" + [61] "base" "Matrix" "base" "Matrix" "base" "base" + [67] "Matrix" "base" "Matrix" "base" "Matrix" "base" + [73] "base" "base" "base" "base" "base" "base" + [79] "base" "base" "base" "methods" "base" "base" + [85] "base" "base" "methods" "Matrix" "base" "base" + [91] "base" "Matrix" "base" "utils" "base" "stats" + [97] "Matrix" "Matrix" "base" "Matrix" "stats" "Matrix" +[103] "base" "Matrix" "base" + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltingsub.testgsub8 #argv <- list(''([^']*)'', '‘\\1’', '‘/home/lzhao/hg/r-instrumented/tests/rpart.Rcheck’', FALSE, FALSE, FALSE, FALSE); .Internal(gsub(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]])) Error: unexpected '[' in "argv <- list(''([" @@ -69817,6 +69976,10 @@ Levels: a.b.c a.b.b.c a.c #argv <- list(structure(1:24, .Dim = 2:4));is.complex(argv[[1]]); [1] FALSE +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltiniscomplex.testiscomplex4 +#argv <- list(NA_complex_);is.complex(argv[[1]]); +[1] TRUE + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltiniscomplex.testiscomplex5 #argv <- list(1.3+0i);is.complex(argv[[1]]); [1] TRUE @@ -70682,6 +70845,10 @@ FALSE [7,] FALSE FALSE FALSE FALSE FALSE [8,] FALSE FALSE FALSE FALSE FALSE +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinisna.testisna35 +#argv <- list(NA_complex_);is.na(argv[[1]]); +[1] TRUE + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinisna.testisna36 #argv <- list(complex(0));is.na(argv[[1]]); logical(0) @@ -70763,6 +70930,10 @@ logical(0) #argv <- list(structure(3.14159265358979, class = structure('3.14159265358979', class = 'testit')));is.null(argv[[1]]); [1] FALSE +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinisnull.testisnull14 +#argv <- list(NA_complex_);do.call('is.null', argv) +[1] FALSE + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinisnull.testisnull15 #argv <- list(complex(real = 3, imaginary = -Inf));do.call('is.null', argv) [1] FALSE @@ -71255,6 +71426,11 @@ logical(0) #argv <- list(structure(list(Plant = structure(c(5L, 5L, 5L, 5L, 5L, 5L, 5L), .Label = c('Qn1', 'Qn2', 'Qn3', 'Qc1', 'Qc3', 'Qc2', 'Mn3', 'Mn2', 'Mn1', 'Mc2', 'Mc3', 'Mc1'), class = c('ordered', 'factor')), Type = structure(c(1L, 1L, 1L, 1L, 1L, 1L, 1L), .Label = c('Quebec', 'Mississippi'), class = 'factor'), Treatment = structure(c(2L, 2L, 2L, 2L, 2L, 2L, 2L), .Label = c('nonchilled', 'chilled'), class = 'factor')), .Names = c('Plant', 'Type', 'Treatment'), class = 'data.frame', row.names = 36:42), 'any'); .Internal(is.vector(argv[[1]], argv[[2]])) [1] FALSE +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinlabels.testlabels1 +#argv <- structure(list(object = structure(c(-469.098459411633, 469.356672501203, -0.429918004252249, 0.00364370239091614, -0.256875513692359, -0.0204799335117722, 2.00613934942808), .Names = c('(Intercept)', 'gravity', 'ph', 'osmo', 'conduct', 'urea', 'log(calc)'))), .Names = 'object');do.call('labels', argv) +[1] "(Intercept)" "gravity" "ph" "osmo" "conduct" +[6] "urea" "log(calc)" + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinlength.testlength1 #argv <- list('~ . + Soft+M.user:Temp');length(argv[[1]]); [1] 1 @@ -72321,6 +72497,15 @@ Vcells 18316380 139.8 26424236 201.7 NA 22608335 172.5 #argv <- list(numeric(0), 1, 1L, FALSE, NULL, TRUE, FALSE); .Internal(matrix(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]])) [,1] +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinmatrix.testmatrix28 +#argv <- list(NA_complex_, 5L, 1L, FALSE, NULL, FALSE, FALSE); .Internal(matrix(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]])) + [,1] +[1,] NA +[2,] NA +[3,] NA +[4,] NA +[5,] NA + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinmatrix.testmatrix3 #argv <- list(NA, 0L, 0L, FALSE, NULL, FALSE, FALSE); .Internal(matrix(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]])) <0 x 0 matrix> @@ -72571,6 +72756,10 @@ object "foo" #argv <- list(numeric(0)); .Internal(mean(argv[[1]])) [1] NaN +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinmean.testmean19 +#argv <- structure(list(x = structure(c(31, NA, NA, 31), units = 'days', class = 'difftime'), na.rm = TRUE), .Names = c('x', 'na.rm'));do.call('mean', argv) +Time difference of 31 days + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinmean.testmean20 #argv <- structure(list(x = c(TRUE, FALSE, TRUE, TRUE)), .Names = 'x');do.call('mean', argv) [1] 0.75 @@ -73067,6 +73256,15 @@ logical(0) 104.6608 +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinoperators.testoperators110 +#argv <- list(structure(list(Fertility = c(80.2, 83.1, 92.5, 85.8, 76.9), Agriculture = c(17, 45.1, 39.7, 36.5, 43.5), Examination = c(15L, 6L, 5L, 12L, 17L), Education = c(12L, 9L, 5L, 7L, 15L)), .Names = c('Fertility', 'Agriculture', 'Examination', 'Education'), row.names = c('Courtelary', 'Delemont', 'Franches-Mnt', 'Moutier', 'Neuveville'), class = 'data.frame'), 6);`<=`(argv[[1]],argv[[2]]); + Fertility Agriculture Examination Education +Courtelary FALSE FALSE FALSE FALSE +Delemont FALSE FALSE TRUE FALSE +Franches-Mnt FALSE FALSE TRUE TRUE +Moutier FALSE FALSE FALSE FALSE +Neuveville FALSE FALSE FALSE FALSE + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinoperators.testoperators111 #argv <- list(c(0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 1L, NA, 2L, 2L, 0L, NA, 1L, 1L), c(0, 0, 0, 0, 0, 0, 0, 0, 1, NA, 2, 2, 0, NA, 1, 1));`==`(argv[[1]],argv[[2]]); [1] TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE NA TRUE TRUE TRUE NA TRUE @@ -73145,6 +73343,11 @@ logical(0) #argv <- list('«Latin-1 accented chars»: ghè øØ å<Å æ<Æ gh ghè', '«Latin-1 accented chars»: ghè øØ å<Å æ<Æ gh ghè');`==`(argv[[1]],argv[[2]]); [1] TRUE +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinoperators.testoperators126 +#argv <- list(structure(list(cde = 2L, cd = 4L), .Names = c('cde', 'cd'), row.names = 'ab', class = 'data.frame'), c(2, 4));`==`(argv[[1]],argv[[2]]); + cde cd +ab TRUE TRUE + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinoperators.testoperators127 #argv <- list(1, structure(c(1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 0L, 1L, 0L, 1L, 1L, 1L, 1L, 1L, 0L, 1L, 0L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L), .Names = c('is.array', 'is.atomic', 'is.call', 'is.character', 'is.complex', 'is.data.frame', 'is.double', 'is.environment', 'is.expression', 'is.factor', 'is.finite', 'is.function', 'is.infinite', 'is.integer', 'is.language', 'is.list', 'is.logical', 'is.matrix', 'is.na', 'is.name', 'is.nan', 'is.null', 'is.numeric', 'is.numeric_version', 'is.object', 'is.ordered', 'is.package_version', 'is.pairlist', 'is.primitive', 'is.qr', 'is.raw', 'is.recursive', 'is.symbol', 'is.table', 'is.vector')));`==`(argv[[1]],argv[[2]]); is.array is.atomic is.call is.character @@ -73517,6 +73720,15 @@ logical(0) #argv <- list(c(TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE), c(TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE));`&`(argv[[1]],argv[[2]]); [1] TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinoperators.testoperators192 +#argv <- list(structure(c(TRUE, FALSE, FALSE, FALSE, FALSE, TRUE, TRUE, TRUE, TRUE, NA), .Dim = c(5L, 2L), .Dimnames = list(NULL, c('VAR1', 'VAR3'))), structure(c(TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, FALSE), .Dim = c(5L, 2L), .Dimnames = list(NULL, c('VAR1', 'VAR3'))));`&`(argv[[1]],argv[[2]]); + VAR1 VAR3 +[1,] TRUE TRUE +[2,] FALSE TRUE +[3,] FALSE TRUE +[4,] FALSE TRUE +[5,] FALSE FALSE + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinoperators.testoperators193 #argv <- list(structure(c(FALSE, FALSE, FALSE, FALSE, TRUE, FALSE, TRUE), .Names = c(' 100', '-1e-13', ' Inf', '-Inf', ' NaN', '3.14', ' NA')), structure(c(TRUE, TRUE, TRUE, TRUE, FALSE, TRUE, TRUE), .Names = c(' 100', '-1e-13', ' Inf', '-Inf', ' NaN', '3.14', ' NA')));`&`(argv[[1]],argv[[2]]); 100 -1e-13 Inf -Inf NaN 3.14 NA @@ -73715,6 +73927,15 @@ FALSE FALSE FALSE FALSE FALSE FALSE FALSE FALSE FALSE FALSE FALSE FALSE #argv <- list(c(-Inf, Inf), c(-Inf, Inf));`==`(argv[[1]],argv[[2]]); [1] TRUE TRUE +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinoperators.testoperators261 +#argv <- list(structure(list(VAR1 = c(1, 2, 3, 4, 5), VAR3 = c(1, 1, 1, 1, NA)), .Names = c('VAR1', 'VAR3'), class = 'data.frame', row.names = c(NA, -5L)), 1);`==`(argv[[1]],argv[[2]]); + VAR1 VAR3 +[1,] TRUE TRUE +[2,] FALSE TRUE +[3,] FALSE TRUE +[4,] FALSE TRUE +[5,] FALSE NA + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinoperators.testoperators262 #argv <- list(structure(1:20, .Dim = c(2L, 2L, 5L)), structure(1:20, .Dim = c(2L, 2L, 5L)));`==`(argv[[1]],argv[[2]]); , , 1 @@ -74005,6 +74226,11 @@ FALSE FALSE FALSE FALSE FALSE FALSE FALSE FALSE FALSE FALSE FALSE FALSE FALSE 40 42 43 44 45 46 47 48 49 50 51 52 53 FALSE FALSE FALSE FALSE FALSE FALSE FALSE FALSE FALSE FALSE FALSE FALSE FALSE +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinoperators.testoperators313 +#argv <- list(structure(c(NA, FALSE, TRUE, NA, FALSE, TRUE, NA, FALSE, TRUE), .Names = c(NA, 'FALSE', 'TRUE', NA, 'FALSE', 'TRUE', NA, 'FALSE', 'TRUE')), structure(c(NA, NA, NA, FALSE, FALSE, FALSE, TRUE, TRUE, TRUE), .Names = c(NA, NA, NA, 'FALSE', 'FALSE', 'FALSE', 'TRUE', 'TRUE', 'TRUE')));`|`(argv[[1]],argv[[2]]); + <NA> FALSE TRUE <NA> FALSE TRUE <NA> FALSE TRUE + NA NA TRUE NA FALSE TRUE TRUE TRUE TRUE + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinoperators.testoperators316 #argv <- list(character(0));`!`(argv[[1]]); logical(0) @@ -74123,6 +74349,10 @@ rate [1] 0 -1 0 -1 -1 0 NA NA 0 0 0 0 0 7 0 8 9 0 0 0 NA 0 0 0 0 [26] 0 NA 0 0 0 0 0 0 0 0 0 0 15 0 16 17 0 0 17 0 18 19 0 +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinoperators.testoperators337 +#argv <- list(c(TRUE, TRUE, TRUE, FALSE, TRUE, TRUE, TRUE, FALSE), c(TRUE, TRUE, TRUE, NA, FALSE, FALSE, TRUE, NA));`&`(argv[[1]],argv[[2]]); +[1] TRUE TRUE TRUE FALSE FALSE FALSE TRUE FALSE + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinoperators.testoperators338 #argv <- list(structure(c(FALSE, FALSE), .Names = c('(Intercept)', 'age')));`!`(argv[[1]]); (Intercept) age @@ -74163,6 +74393,11 @@ is.na.numeric_version is.name is.nan is.vector TRUE +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinoperators.testoperators342 +#argv <- list(structure(c(NA, FALSE, TRUE, NA, FALSE, TRUE, NA, FALSE, TRUE), .Names = c(NA, 'FALSE', 'TRUE', NA, 'FALSE', 'TRUE', NA, 'FALSE', 'TRUE')), structure(c(NA, NA, NA, FALSE, FALSE, FALSE, TRUE, TRUE, TRUE), .Names = c(NA, NA, NA, 'FALSE', 'FALSE', 'FALSE', 'TRUE', 'TRUE', 'TRUE')));`&`(argv[[1]],argv[[2]]); + <NA> FALSE TRUE <NA> FALSE TRUE <NA> FALSE TRUE + NA FALSE NA FALSE FALSE FALSE NA FALSE TRUE + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinoperators.testoperators344 #argv <- list(list());`&`(argv[[1]]); logical(0) @@ -74301,6 +74536,13 @@ data #argv <- list(41L, 0L);`-`(argv[[1]],argv[[2]]); [1] 41 +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinoperators.testoperators51 +#argv <- list(structure(c(94694400, 126230400, 157766400, 189302400, 220924800, 252460800, 283996800, 315532800, 362793600, 394329600, 425865600, 489024000, 567993600, 631152000, 662688000, 709948800, 741484800, 773020800, 820454400, 867715200, 915148800, 1136073600, 1230768000, 1341100800), class = c('POSIXct', 'POSIXt')), structure(c(78796800, 94694400, 126230400, 157766400, 189302400, 220924800, 252460800, 283996800, 315532800, 362793600, 394329600, 425865600, 489024000, 567993600, 631152000, 662688000, 709948800, 741484800, 773020800, 820454400, 867715200, 1136073600, 1230768000, 1341100800), class = c('POSIXct', 'POSIXt')));`-`(argv[[1]],argv[[2]]); +Time differences in secs + [1] 15897600 31536000 31536000 31536000 31622400 31536000 31536000 31536000 + [9] 47260800 31536000 31536000 63158400 78969600 63158400 31536000 47260800 +[17] 31536000 31536000 47433600 47260800 47433600 0 0 0 + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinoperators.testoperators53 #argv <- list(structure(c(58.56, 2.776, 61.341, 0, 0), .Names = c('user.self', 'sys.self', 'elapsed', 'user.child', 'sys.child'), class = 'proc_time'), structure(c(40.692, 0.307, 41, 0, 0), .Names = c('user.self', 'sys.self', 'elapsed', 'user.child', 'sys.child'), class = 'proc_time'));`-`(argv[[1]],argv[[2]]); user system elapsed @@ -74507,6 +74749,30 @@ data [9,] 0 0 0 0 0 0 0 0 -1 0 [10,] 0 0 0 0 0 0 0 0 0 -1 +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinoperators.testoperators63 +#argv <- list(structure(list(war = c(1L, 1L, 2L, 1L, 2L, 2L, 2L, 2L, 2L, 1L, 1L, 1L, 2L, 1L, 1L, 2L, 2L, 1L, 1L, 2L), fly = c(1L, 2L, 1L, 1L, 1L, 1L, 2L, 2L, 1L, 2L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L), ver = c(1L, 1L, 2L, 1L, 2L, 2L, 2L, 2L, 2L, 1L, 2L, 2L, 2L, 2L, 1L, 2L, 2L, 2L, 1L, 2L), end = c(1L, 1L, 1L, 1L, 2L, 1L, 1L, 2L, 2L, 1L, 2L, 1L, NA, 1L, 1L, 2L, 1L, 1L, NA, 2L), gro = c(2L, 2L, 1L, 1L, 2L, 2L, 2L, 1L, 2L, 1L, NA, 2L, 2L, 1L, NA, 2L, 2L, NA, 1L, 2L), hai = c(1L, 2L, 2L, 2L, 2L, 2L, 1L, 1L, 1L, 1L, 1L, 1L, 2L, 1L, 1L, 2L, 2L, 1L, 2L, 1L)), .Names = c('war', 'fly', 'ver', 'end', 'gro', 'hai'), class = 'data.frame', row.names = c('ant', 'bee', 'cat', 'cpl', 'chi', 'cow', 'duc', 'eag', 'ele', 'fly', 'fro', 'her', 'lio', 'liz', 'lob', 'man', 'rab', 'sal', 'spi', 'wha')), 1);`-`(argv[[1]],argv[[2]]); + war fly ver end gro hai +ant 0 0 0 0 1 0 +bee 0 1 0 0 1 1 +cat 1 0 1 0 0 1 +cpl 0 0 0 0 0 1 +chi 1 0 1 1 1 1 +cow 1 0 1 0 1 1 +duc 1 1 1 0 1 0 +eag 1 1 1 1 0 0 +ele 1 0 1 1 1 0 +fly 0 1 0 0 0 0 +fro 0 0 1 1 NA 0 +her 0 0 1 0 1 0 +lio 1 0 1 NA 1 1 +liz 0 0 1 0 0 0 +lob 0 0 0 0 NA 0 +man 1 0 1 1 1 1 +rab 1 0 1 0 1 1 +sal 0 0 1 0 NA 0 +spi 0 0 0 NA 0 1 +wha 1 0 1 1 1 0 + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinoperators.testoperators65 #argv <- list(c(41L, 36L, 12L, 18L, NA, 28L, 23L, 19L, 8L, NA, 7L, 16L, 11L, 14L, 18L, 14L, 34L, 6L, 30L, 11L, 1L, 11L, 4L, 32L, NA, NA, NA, 23L, 45L, 115L, 37L, NA, NA, NA, NA, NA, NA, 29L, NA, 71L, 39L, NA, NA, 23L, NA, NA, 21L, 37L, 20L, 12L, 13L, NA, NA, NA, NA, NA, NA, NA, NA, NA, NA, 135L, 49L, 32L, NA, 64L, 40L, 77L, 97L, 97L, 85L, NA, 10L, 27L, NA, 7L, 48L, 35L, 61L, 79L, 63L, 16L, NA, NA, 80L, 108L, 20L, 52L, 82L, 50L, 64L, 59L, 39L, 9L, 16L, 78L, 35L, 66L, 122L, 89L, 110L, NA, NA, 44L, 28L, 65L, NA, 22L, 59L, 23L, 31L, 44L, 21L, 9L, NA, 45L, 168L, 73L, NA, 76L, 118L, 84L, 85L, 96L, 78L, 73L, 91L, 47L, 32L, 20L, 23L, 21L, 24L, 44L, 21L, 28L, 9L, 13L, 46L, 18L, 13L, 24L, 16L, 13L, 23L, 36L, 7L, 14L, 30L, NA, 14L, 18L, 20L));`-`(argv[[1]]); [1] -41 -36 -12 -18 NA -28 -23 -19 -8 NA -7 -16 -11 -14 -18 @@ -75378,6 +75644,10 @@ y ~ A:U + A:V - 1 [31] "NM" "NY" "NC" "ND" "Oh" "Ok" "Or" "Pn" "RI" "SC" [41] "SD" "Tn" "Tx" "Ut" "Vrm" "Vrg" "Wsh" "WV" "Wsc" "Wy" +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinprintfunction.testprintfunction4 +#argv <- list(.Primitive('.Internal'), TRUE); .Internal(print.function(argv[[1]], argv[[2]])) +function (call) .Primitive(".Internal") + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinprod.testprod1 #argv <- list(9L);prod(argv[[1]]); [1] 9 @@ -76006,6 +76276,33 @@ Malaysia 1 1 1 1 [25] 0.111111111 0.062500000 0.027777778 0.040000000 0.023668639 0.040000000 [31] 0.010000000 0.027777778 0.003086420 0.049382716 0.002500000 +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsep.testsep14 +#argv <- list(structure(list(A = c(52L, 52L, 47L, 45L, 40L, 37L, 27L, 27L, 23L, 22L, 21L, 25L, 24L, 22L, 22L, 20L, 16L, 17L, 14L, 13L, 13L, 14L, 24L), F = c(42L, 44L, 48L, 49L, 50L, 54L, 58L, 54L, 59L, 59L, 60L, 53L, 54L, 55L, 56L, 58L, 62L, 57L, 54L, 55L, 52L, 47L, 56L), M = c(6L, 4L, 5L, 6L, 10L, 9L, 15L, 19L, 18L, 19L, 19L, 22L, 22L, 23L, 22L, 22L, 22L, 26L, 32L, 32L, 35L, 39L, 20L)), .Names = c('A', 'F', 'M'), class = 'data.frame', row.names = c(NA, 23L)), 100);`/`(argv[[1]],argv[[2]]); + A F M +1 0.52 0.42 0.06 +2 0.52 0.44 0.04 +3 0.47 0.48 0.05 +4 0.45 0.49 0.06 +5 0.40 0.50 0.10 +6 0.37 0.54 0.09 +7 0.27 0.58 0.15 +8 0.27 0.54 0.19 +9 0.23 0.59 0.18 +10 0.22 0.59 0.19 +11 0.21 0.60 0.19 +12 0.25 0.53 0.22 +13 0.24 0.54 0.22 +14 0.22 0.55 0.23 +15 0.22 0.56 0.22 +16 0.20 0.58 0.22 +17 0.16 0.62 0.22 +18 0.17 0.57 0.26 +19 0.14 0.54 0.32 +20 0.13 0.55 0.32 +21 0.13 0.52 0.35 +22 0.14 0.47 0.39 +23 0.24 0.56 0.20 + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsep.testsep15 #argv <- list(c(1, 0), structure(c(1, 0, 0, 1), .Dim = c(2L, 2L)));`/`(argv[[1]],argv[[2]]); [,1] [,2] @@ -76454,6 +76751,13 @@ integer(0) [4,] 0.2798734 -0.2717041 -0.7945601 [5,] 0.8192892 0.6027311 0.7009196 +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsink.testsink1 +#argv <- list(structure(2L, class = c('terminal', 'connection')), FALSE, TRUE, FALSE); .Internal(sink(argv[[1]], argv[[2]], argv[[3]], argv[[4]])) + +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsinknumber.testsinknumber1 +#argv <- list(FALSE); .Internal(sink.number(argv[[1]])) +[1] 2 + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsort.testsort1 #argv <- list('x1', FALSE); .Internal(sort(argv[[1]], argv[[2]])) [1] "x1" @@ -76630,6 +76934,10 @@ $`4` [17] 123.7872 123.7872 +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsplit.testsplit15 +#argv <- list(character(0), structure(integer(0), .Label = character(0), class = 'factor')); .Internal(split(argv[[1]], argv[[2]])) +named list() + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsplit.testsplit17 #argv <- structure(list(x = c(5.1, 4.9, 4.7, 4.6, 5, 5.4, 4.6, 5, 4.4, 4.9, 5.4, 4.8, 4.8, 4.3, 5.8, 5.7, 5.4, 5.1, 5.7, 5.1, 5.4, 5.1, 4.6, 5.1, 4.8, 5, 5, 5.2, 5.2, 4.7, 4.8, 5.4, 5.2, 5.5, 4.9, 5, 5.5, 4.9, 4.4, 5.1, 5, 4.5, 4.4, 5, 5.1, 4.8, 5.1, 4.6, 5.3, 5, 7, 6.4, 6.9, 5.5, 6.5, 5.7, 6.3, 4.9, 6.6, 5.2, 5, 5.9, 6, 6.1, 5.6, 6.7, 5.6, 5.8, 6.2, 5.6, 5.9, 6.1, 6.3, 6.1, 6.4, 6.6, 6.8, 6.7, 6, 5.7, 5.5, 5.5, 5.8, 6, 5.4, 6, 6.7, 6.3, 5.6, 5.5, 5.5, 6.1, 5.8, 5, 5.6, 5.7, 5.7, 6.2, 5.1, 5.7, 6.3, 5.8, 7.1, 6.3, 6.5, 7.6, 4.9, 7.3, 6.7, 7.2, 6.5, 6.4, 6.8, 5.7, 5.8, 6.4, 6.5, 7.7, 7.7, 6, 6.9, 5.6, 7.7, 6.3, 6.7, 7.2, 6.2, 6.1, 6.4, 7.2, 7.4, 7.9, 6.4, 6.3, 6.1, 7.7, 6.3, 6.4, 6, 6.9, 6.7, 6.9, 5.8, 6.8, 6.7, 6.7, 6.3, 6.5, 6.2, 5.9), f = structure(list(col2 = structure(c(3L, 2L, 2L, 2L, 3L, 3L, 2L, 2L, 2L, 2L, 3L, 2L, 2L, 2L, 3L, 3L, 3L, 3L, 3L, 3L, 2L, 3L, 3L, 2L, 2L, 2L, 2L, 3L, 2L, 2L, 2L, 2L, 3L, 3L, 2L, 2L, 3L, 3L, 2L, 2L, 3L, 1L, 2L, 3L, 3L, 2L, 3L, 2L, 3L, 2L, 2L, 2L, 2L, 1L, 2L, 2L, 2L, 1L, 2L, 2L, 1L, 2L, 1L, 2L, 2L, 2L, 2L, 2L, 1L, 1L, 2L, 2L, 1L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 1L, 1L, 2L, 2L, 2L, 2L, 2L, 1L, 2L, 1L, 2L, 2L, 2L, 1L, 2L, 2L, 2L, 2L, 1L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 1L, 2L, 1L, 3L, 2L, 2L, 2L, 1L, 2L, 2L, 2L, 3L, 2L, 1L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 3L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 1L, 2L, 2L, 2L), .Label = c('2', '3', '4'), class = 'factor'), col5 = structure(c(1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L), .Label = c('setosa', 'versicolor', 'virginica'), class = 'factor')), .Names = c('col2', 'col5'))), .Names = c('x', 'f'));do.call('split', argv) $`2.setosa` @@ -76719,6 +77027,35 @@ $`5` [26] 30 NA 14 18 20 +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsplit.testsplit7 +#argv <- list(structure(c('Sex/(Age + Eth * Lrn)', 'Sex + Sex:Age + Sex:Eth + Sex:Lrn + Sex:Eth:Lrn + Sex:Age:Lrn', 'Sex + Sex:Age + Sex:Eth + Sex:Lrn + Sex:Eth:Lrn + Sex:Age:Lrn + Sex:Age:Eth + Sex:Age:Eth:Lrn', '1.597991', '1.686899', '1.928360', '132', '128', '118', '-1063.025', '-1055.398', '-1039.324', '', '1 vs 2', '2 vs 3', '', ' 4', '10', '', ' 7.627279', '16.073723', '', '0.10622602', '0.09754136'), .Dim = c(3L, 8L)), structure(c(1L, 1L, 1L, 2L, 2L, 2L, 3L, 3L, 3L, 4L, 4L, 4L, 5L, 5L, 5L, 6L, 6L, 6L, 7L, 7L, 7L, 8L, 8L, 8L), .Label = c('1', '2', '3', '4', '5', '6', '7', '8'), class = 'factor')); .Internal(split(argv[[1]], argv[[2]])) +$`1` +[1] "Sex/(Age + Eth * Lrn)" +[2] "Sex + Sex:Age + Sex:Eth + Sex:Lrn + Sex:Eth:Lrn + Sex:Age:Lrn" +[3] "Sex + Sex:Age + Sex:Eth + Sex:Lrn + Sex:Eth:Lrn + Sex:Age:Lrn + Sex:Age:Eth + Sex:Age:Eth:Lrn" + +$`2` +[1] "1.597991" "1.686899" "1.928360" + +$`3` +[1] "132" "128" "118" + +$`4` +[1] "-1063.025" "-1055.398" "-1039.324" + +$`5` +[1] "" "1 vs 2" "2 vs 3" + +$`6` +[1] "" " 4" "10" + +$`7` +[1] "" " 7.627279" "16.073723" + +$`8` +[1] "" "0.10622602" "0.09754136" + + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsplit.testsplit8 #argv <- list(c(0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 1L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L, 0L), structure(c(60L, 60L, 60L, 60L, 61L, 61L, 61L, 61L, 62L, 62L, 62L, 62L, 63L, 63L, 63L, 63L, 64L, 64L, 64L, 64L, 65L, 65L, 65L, 65L, 66L, 66L, 66L, 66L, 67L, 67L, 67L, 67L, 68L, 68L, 68L, 68L, 69L, 69L, 69L, 69L, 70L, 70L, 70L, 70L, 71L, 71L, 71L, 71L, 72L, 72L, 72L, 72L, 73L, 73L, 73L, 73L, 74L, 74L, 74L, 74L, 75L, 75L, 75L, 75L, 76L, 76L, 76L, 76L, 77L, 77L, 77L, 77L, 78L, 78L, 78L, 78L, 79L, 79L, 79L, 79L, 80L, 80L, 80L, 80L, 81L, 81L, 81L, 81L, 82L, 82L, 82L, 82L, 83L, 83L, 83L, 83L, 84L, 84L, 84L, 84L, 85L, 85L, 85L, 85L, 86L, 86L, 86L, 86L, 87L, 87L, 87L, 87L, 88L, 88L, 88L, 88L, 89L, 89L, 89L, 89L, 90L, 90L, 90L, 90L, 91L, 91L, 91L, 91L, 92L, 92L, 92L, 92L, 93L, 93L, 93L, 93L, 94L, 94L, 94L, 94L, 95L, 95L, 95L, 95L, 96L, 96L, 96L, 96L, 97L, 97L, 97L, 97L, 98L, 98L, 98L, 98L, 99L, 99L, 99L, 99L, 100L, 100L, 100L, 100L, 101L, 101L, 101L, 101L, 102L, 102L, 102L, 102L, 103L, 103L, 103L, 103L, 104L, 104L, 104L, 104L, 105L, 105L, 105L, 105L, 106L, 106L, 106L, 106L, 107L, 107L, 107L, 107L, 108L, 108L, 108L, 108L, 109L, 109L, 109L, 109L, 110L, 110L, 110L, 110L, 111L, 111L, 111L, 111L, 112L, 112L, 112L, 112L, 113L, 113L, 113L, 113L, 114L, 114L, 114L, 114L, 115L, 115L, 115L, 115L, 116L, 116L, 116L, 116L, 117L, 117L, 117L, 117L, 118L, 118L, 118L, 118L, 1L, 2L, 3L, 4L, 5L, 6L, 7L, 8L, 9L, 10L, 11L, 12L, 13L, 14L, 15L, 16L, 17L, 18L, 19L, 20L, 21L, 22L, 23L, 24L, 25L, 26L, 27L, 28L, 29L, 30L, 31L, 32L, 33L, 34L, 35L, 36L, 37L, 38L, 39L, 40L, 41L, 42L, 43L, 44L, 45L, 46L, 47L, 48L, 49L, 50L, 51L, 52L, 53L, 54L, 55L, 56L, 57L, 58L, 59L), .Label = c('0', '1', '2', '3', '4', '5', '6', '7', '8', '9', '10', '11', '12', '13', '14', '15', '16', '17', '18', '19', '20', '21', '22', '23', '24', '25', '26', '27', '28', '29', '30', '31', '32', '33', '34', '35', '36', '37', '38', '39', '40', '41', '42', '43', '44', '45', '46', '47', '48', '49', '50', '51', '52', '53', '54', '55', '56', '57', '58', '59', '60', '61', '62', '63', '64', '65', '66', '67', '68', '69', '70', '71', '72', '73', '74', '75', '76', '77', '78', '79', '80', '81', '82', '83', '84', '85', '86', '87', '88', '89', '90', '91', '92', '93', '94', '95', '96', '97', '98', '99', '100', '101', '102', '103', '104', '105', '106', '107', '108', '109', '110', '111', '112', '113', '114', '115', '116', '117'), class = 'factor')); .Internal(split(argv[[1]], argv[[2]])) $`0` @@ -77076,10 +77413,110 @@ $`117` [1] 0 0 0 1 +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsplit.testsplit9 +#argv <- list(structure(c(NA, NA), .Dim = 1:2), structure(1:2, .Label = c('1', '2'), class = 'factor')); .Internal(split(argv[[1]], argv[[2]])) +$`1` +[1] NA + +$`2` +[1] NA + + +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsprintf.testsprintf1 +#argv <- list('%s is not TRUE', 'identical(fxy, c(1, 2, 3))'); .Internal(sprintf(argv[[1]], argv[[2]])) +[1] "identical(fxy, c(1, 2, 3)) is not TRUE" + +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsprintf.testsprintf11 +#argv <- list('%1$d %1$x %1$X', 0:15); .Internal(sprintf(argv[[1]], argv[[2]])) + [1] "0 0 0" "1 1 1" "2 2 2" "3 3 3" "4 4 4" "5 5 5" "6 6 6" "7 7 7" + [9] "8 8 8" "9 9 9" "10 a A" "11 b B" "12 c C" "13 d D" "14 e E" "15 f F" + +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsprintf.testsprintf12 +#argv <- list('%03o', 1:255); .Internal(sprintf(argv[[1]], argv[[2]])) + [1] "001" "002" "003" "004" "005" "006" "007" "010" "011" "012" "013" "014" + [13] "015" "016" "017" "020" "021" "022" "023" "024" "025" "026" "027" "030" + [25] "031" "032" "033" "034" "035" "036" "037" "040" "041" "042" "043" "044" + [37] "045" "046" "047" "050" "051" "052" "053" "054" "055" "056" "057" "060" + [49] "061" "062" "063" "064" "065" "066" "067" "070" "071" "072" "073" "074" + [61] "075" "076" "077" "100" "101" "102" "103" "104" "105" "106" "107" "110" + [73] "111" "112" "113" "114" "115" "116" "117" "120" "121" "122" "123" "124" + [85] "125" "126" "127" "130" "131" "132" "133" "134" "135" "136" "137" "140" + [97] "141" "142" "143" "144" "145" "146" "147" "150" "151" "152" "153" "154" +[109] "155" "156" "157" "160" "161" "162" "163" "164" "165" "166" "167" "170" +[121] "171" "172" "173" "174" "175" "176" "177" "200" "201" "202" "203" "204" +[133] "205" "206" "207" "210" "211" "212" "213" "214" "215" "216" "217" "220" +[145] "221" "222" "223" "224" "225" "226" "227" "230" "231" "232" "233" "234" +[157] "235" "236" "237" "240" "241" "242" "243" "244" "245" "246" "247" "250" +[169] "251" "252" "253" "254" "255" "256" "257" "260" "261" "262" "263" "264" +[181] "265" "266" "267" "270" "271" "272" "273" "274" "275" "276" "277" "300" +[193] "301" "302" "303" "304" "305" "306" "307" "310" "311" "312" "313" "314" +[205] "315" "316" "317" "320" "321" "322" "323" "324" "325" "326" "327" "330" +[217] "331" "332" "333" "334" "335" "336" "337" "340" "341" "342" "343" "344" +[229] "345" "346" "347" "350" "351" "352" "353" "354" "355" "356" "357" "360" +[241] "361" "362" "363" "364" "365" "366" "367" "370" "371" "372" "373" "374" +[253] "375" "376" "377" + +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsprintf.testsprintf13 +#argv <- list('%d y value <= 0 omitted from logarithmic plot', 1L); .Internal(sprintf(argv[[1]], argv[[2]])) +[1] "1 y value <= 0 omitted from logarithmic plot" + +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsprintf.testsprintf14 +#argv <- list('%o', 1:255); .Internal(sprintf(argv[[1]], argv[[2]])) + [1] "1" "2" "3" "4" "5" "6" "7" "10" "11" "12" "13" "14" + [13] "15" "16" "17" "20" "21" "22" "23" "24" "25" "26" "27" "30" + [25] "31" "32" "33" "34" "35" "36" "37" "40" "41" "42" "43" "44" + [37] "45" "46" "47" "50" "51" "52" "53" "54" "55" "56" "57" "60" + [49] "61" "62" "63" "64" "65" "66" "67" "70" "71" "72" "73" "74" + [61] "75" "76" "77" "100" "101" "102" "103" "104" "105" "106" "107" "110" + [73] "111" "112" "113" "114" "115" "116" "117" "120" "121" "122" "123" "124" + [85] "125" "126" "127" "130" "131" "132" "133" "134" "135" "136" "137" "140" + [97] "141" "142" "143" "144" "145" "146" "147" "150" "151" "152" "153" "154" +[109] "155" "156" "157" "160" "161" "162" "163" "164" "165" "166" "167" "170" +[121] "171" "172" "173" "174" "175" "176" "177" "200" "201" "202" "203" "204" +[133] "205" "206" "207" "210" "211" "212" "213" "214" "215" "216" "217" "220" +[145] "221" "222" "223" "224" "225" "226" "227" "230" "231" "232" "233" "234" +[157] "235" "236" "237" "240" "241" "242" "243" "244" "245" "246" "247" "250" +[169] "251" "252" "253" "254" "255" "256" "257" "260" "261" "262" "263" "264" +[181] "265" "266" "267" "270" "271" "272" "273" "274" "275" "276" "277" "300" +[193] "301" "302" "303" "304" "305" "306" "307" "310" "311" "312" "313" "314" +[205] "315" "316" "317" "320" "321" "322" "323" "324" "325" "326" "327" "330" +[217] "331" "332" "333" "334" "335" "336" "337" "340" "341" "342" "343" "344" +[229] "345" "346" "347" "350" "351" "352" "353" "354" "355" "356" "357" "360" +[241] "361" "362" "363" "364" "365" "366" "367" "370" "371" "372" "373" "374" +[253] "375" "376" "377" + +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsprintf.testsprintf15 +#argv <- list('%s-class.Rd', structure('foo', .Names = 'foo')); .Internal(sprintf(argv[[1]], argv[[2]])) +[1] "foo-class.Rd" + +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsprintf.testsprintf16 +#argv <- list('checkRd: (%d) %s', -3, 'evalSource.Rd:157: Unnecessary braces at ‘{\'sourceEnvironment\'}’'); .Internal(sprintf(argv[[1]], argv[[2]], argv[[3]])) +[1] "checkRd: (-3) evalSource.Rd:157: Unnecessary braces at ‘{'sourceEnvironment'}’" + +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsprintf.testsprintf17 +#argv <- list('tools:::check_compiled_code(\'%s\')', '/home/lzhao/hg/r-instrumented/library/foreign'); .Internal(sprintf(argv[[1]], argv[[2]])) +[1] "tools:::check_compiled_code('/home/lzhao/hg/r-instrumented/library/foreign')" + +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsprintf.testsprintf19 +#argv <- list('%G', 3.14159265358979e-06); .Internal(sprintf(argv[[1]], argv[[2]])) +[1] "3.14159E-06" + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsprintf.testsprintf21 #argv <- structure(list(fmt = '%9.4g', 12345.6789), .Names = c('fmt', ''));do.call('sprintf', argv) [1] "1.235e+04" +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsprintf.testsprintf4 +#argv <- list('%o', integer(0)); .Internal(sprintf(argv[[1]], argv[[2]])) +character(0) + +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsprintf.testsprintf5 +#argv <- list('%*s', 1, ''); .Internal(sprintf(argv[[1]], argv[[2]], argv[[3]])) +[1] " " + +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsprintf.testsprintf6 +#argv <- list('p,L,S = (%2d,%2d,%2d): ', TRUE, TRUE, FALSE); .Internal(sprintf(argv[[1]], argv[[2]], argv[[3]], argv[[4]])) +[1] "p,L,S = ( 1, 1, 0): " + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsqrt.testsqrt1 #argv <- list(12.8025995273675);sqrt(argv[[1]]); [1] 3.578072 @@ -77229,6 +77666,12 @@ B FALSE TRUE [1] "exNSS4" +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinstrsplit.teststrsplit11 +#argv <- list(structure('pkgB', .Names = 'name'), '_', TRUE, FALSE, FALSE); .Internal(strsplit(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]])) +$name +[1] "pkgB" + + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinstrsplit.teststrsplit13 #argv <- list('x', '', FALSE, FALSE, FALSE); .Internal(strsplit(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]])) [[1]] @@ -77270,6 +77713,11 @@ integer(0) #argv <- list('^..dfd.', '', c('aa', '..dfd.row.names'), FALSE, FALSE, FALSE, FALSE); .Internal(sub(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]])) [1] "aa" "row.names" +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsub.testsub10 +#argv <- list('^[[:space:]]*([[:alnum:].]+).*$', '\\1', structure('MASS', .Names = 'Suggests'), FALSE, FALSE, FALSE, FALSE); .Internal(sub(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]])) +Suggests + "MASS" + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsub.testsub11 #argv <- list(' +$', '', c(NA, '1', NA, '2', '1', NA, NA, '1', '4', '1', NA, '4', '1', '3', NA, '4', '2', '2', NA, '4', '4', '2', '4', '4', '2', '1', '4', '4', '3', '1', '1', '4', '1', '4', NA, '1', '4', '4', '2', '2', '4', '4', '3', '4', '2', '2', '3', '3', '4', '1', '1', '1', '4', '1', '4', '4', '4', '4', NA, '4', '4', '4', NA, '1', '2', '3', '4', '3', '4', '2', '4', '4', '1', '4', '1', '4', NA, '4', '2', '1', '4', '1', '1', '1', '4', '4', '2', '4', '1', '1', '1', '4', '1', '1', '1', '4', '3', '1', '4', '3', '2', '4', '3', '1', '4', '2', '4', NA, '4', '4', '4', '2', '1', '4', '4', NA, '2', '4', '4', '1', '1', '1', '1', '4', '1', '2', '3', '2', '1', '4', '4', '4', '1', NA, '4', '2', '2', '2', '4', '4', '3', '3', '4', '2', '4', '3', '1', '1', '4', '2', '4', '3', '1', '4', '3', '4', '4', '1', '1', '4', '4', '3', '1', '1', '2', '1', '3', '4', '2', '2', '2', '4', '4', '3', '2', '1', '1', '4', '1', '1', '2', NA, '2', '3', '3', '2', '1', '1', '1', '1', '4', '4', '4', '4', '4', '4', '2', '2', '1', '4', '1', '4', '3', '4', '2', '3', '1', '3', '1', '4', '1', '4', '1', '4', '3', '3', '4', '4', '1', NA, '3', '4', '4', '4', '4', '4', '4', '3', '4', '3', '4', '2', '4', '4', '1', '2', NA, '4', '4', '4', '4', '1', '2', '1', '1', '2', '1', '4', '2', '3', '1', '4', '4', '4', '1', '2', '1', '4', '2', '1', '3', '1', '2', '2', '1', '2', '1', NA, '3', '2', '2', '4', '1', '4', '4', '2', '4', '4', '4', '2', '1', '4', '2', '4', '4', '4', '4', '4', '1', '3', '4', '3', '4', '1', NA, '4', NA, '1', '1', '1', '4', '4', '4', '4', '2', '4', '3', '2', NA, '1', '4', '4', '3', '4', '4', '4', '2', '4', '2', '1', '4', '4', NA, '4', '4', '3', '3', '4', '2', '2', '4', '1', '4', '4', '4', '3', '4', '4', '4', '3', '2', '1', '3', '1', '4', '1', '4', '2', NA, '1', '4', '4', '3', '1', '4', '1', '4', '1', '4', '4', '1', '2', '2', '1', '4', '1', '1', '4', NA, '4', NA, '4', '4', '4', '1', '4', '2', '1', '2', '2', '2', '2', '1', '1', '2', '1', '4', '2', '3', '3', '1', '3', '1', '4', '1', '3', '2', '2', '4', '1', NA, '3', '4', '2', '4', '4', '4', '4', '4', '4', '3', '4', '4', '3', '2', '1', '4', '4', '2', '4', '2', '1', '2', '1', '1', '1', '1', '4', '4', '1', '1', '4', '1', '4', '4', '4', '1', '1', NA, '3', '2', '4', '4', '4', '4', '2', '3', '3', '2', NA, '4', '2', '4', '4', '1', '1', '4', '4', '1', '1', '4', '1', '2', '2', '2', '2', '1', '4', '4', '1', '2', '2', '2', '3', '4', '4', '3', '4', '1', '1', '4', '4', NA, '4', '1', '4', '4', '4', '1', '4', '4', '1', '2', '4', '4', '4', '4', '1', '2', '4', '4', '2', '1', '4', '2', '4', '2', '2', '4', '1', '3', '3', '2', '4', '1', '4', '4', '4', '1', NA, '4', '4', '2', '4', '4', '4', '4', '4', '2', NA, '4', '2', '4', '3', '1', '4', '4', '3', '4', '2', '4', '4', '1', '2', '1', '4', '1', '3', '3', '1', '4', '4', '2', '4', '4', '4', '4', '3', '2', '3', '3', '2', NA, '3', '4', '4', '3', '3', '4', '4', '4', '1', '4', '4', '4', '4', '4', '4', '4', '2', '4', '2', '3', '4', '1', '3', '1', NA, '4', '1', '2', '2', '1', '4', '3', '3', '4', '1', '1', '3'), FALSE, FALSE, FALSE, FALSE); .Internal(sub(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]])) [1] NA "1" NA "2" "1" NA NA "1" "4" "1" NA "4" "1" "3" NA "4" "2" "2" @@ -77314,6 +77762,10 @@ integer(0) [9] "TypeMidsize" "TypeSmall" "TypeSporty" "TypeVan" [13] "EngineSize" "DriveTrainFront" "DriveTrainRear" +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsub.testsub17 +#argv <- list('^msgstr[[:blank:]]+[\'](.*)[\'][[:blank:]]*$', '\\1', 'msgstr \'<U+043E><U+0442><U+0440><U+0438><U+0446><U+0430><U+0442><U+0435><U+043B><U+044C><U+043D><U+044B><U+0435> <U+0432><U+0435><U+0441><U+0430> <U+043D><U+0435> <U+0440><U+0430><U+0437><U+0440><U+0435><U+0448><U+0435><U+043D><U+044B>\'', FALSE, FALSE, FALSE, FALSE); .Internal(sub(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]])) +[1] "<U+043E><U+0442><U+0440><U+0438><U+0446><U+0430><U+0442><U+0435><U+043B><U+044C><U+043D><U+044B><U+0435> <U+0432><U+0435><U+0441><U+0430> <U+043D><U+0435> <U+0440><U+0430><U+0437><U+0440><U+0435><U+0448><U+0435><U+043D><U+044B>" + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinsub.testsub19 #argv <- list('([^:]*):(.*)', '\\2', character(0), FALSE, FALSE, FALSE, FALSE); .Internal(sub(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]])) character(0) @@ -78293,12 +78745,32 @@ NULL #argv <- list(c('colors', 'colours'), FALSE, FALSE, NA); .Internal(unique(argv[[1]], argv[[2]], argv[[3]], argv[[4]])) [1] "colors" "colours" +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinunique.testunique7 +#argv <- list(structure(list(a = 1), .Names = 'a'), FALSE, FALSE, NA); .Internal(unique(argv[[1]], argv[[2]], argv[[3]], argv[[4]])) +[[1]] +[1] 1 + + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinunique.testunique8 #argv <- list(c(1, 258, 516, 774, 1032, 1290, 1548, 1806, 2064, 2322, 2580, 2838, 3096, 3354, 3612, 3870, 4128, 4386, 4644, 4902, 5160, 1, 259, 517, 775, 1033, 1291, 1549, 1807, 2065, 2323, 2581, 2839, 3097, 3355, 3613, 3871, 4129, 4387, 4645, 4903, 5160), FALSE, FALSE, NA); .Internal(unique(argv[[1]], argv[[2]], argv[[3]], argv[[4]])) [1] 1 258 516 774 1032 1290 1548 1806 2064 2322 2580 2838 3096 3354 3612 [16] 3870 4128 4386 4644 4902 5160 259 517 775 1033 1291 1549 1807 2065 2323 [31] 2581 2839 3097 3355 3613 3871 4129 4387 4645 4903 +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinunique.testunique9 +#argv <- list(list(FALSE), FALSE, FALSE, NA); .Internal(unique(argv[[1]], argv[[2]], argv[[3]], argv[[4]])) +[[1]] +[1] FALSE + + +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinunitsassign_.testunitsassign_1 +#argv <- structure(list(x = structure(500, units = 'secs', class = 'difftime', .Names = 'a'), value = 'mins'), .Names = c('x', 'value'));do.call('units<-', argv) +Time difference of 8.333333 mins + +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinunitsassign_difftime.testunitsassign_difftime1 +#argv <- structure(list(x = structure(500, units = 'secs', class = 'difftime', .Names = 'a'), value = 'mins'), .Names = c('x', 'value'));do.call('units<-.difftime', argv) +Time difference of 8.333333 mins + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinvector.testvector1 #argv <- list('integer', 0L); .Internal(vector(argv[[1]], argv[[2]])) integer(0) @@ -78322,6 +78794,10 @@ NULL #argv <- list('double', 2); .Internal(vector(argv[[1]], argv[[2]])) [1] 0 0 +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinvector.testvector9 +#argv <- list('raw', 0L); .Internal(vector(argv[[1]], argv[[2]])) +raw(0) + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinwhich.testwhich1 #argv <- list(c(FALSE, FALSE, FALSE, FALSE, FALSE, FALSE, FALSE, FALSE, FALSE, FALSE, FALSE, FALSE, FALSE, FALSE, FALSE, FALSE, FALSE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE)); .Internal(which(argv[[1]])) [1] 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 @@ -78369,6 +78845,9 @@ named integer(0) #argv <- list(c(7985.84636551931, 7366.07281363396, 7342.71367123673, 7315.48787041648, 7290.90503004105)); .Internal(which.max(argv[[1]])) [1] 1 +##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinwriteLines.testwriteLines1 +#argv <- structure(list(text = ' \' A \'; \'B\' ;\'C\';\' D \';\'E \'; F ;G ', con = 'foo'), .Names = c('text', 'con'));do.call('writeLines', argv) + ##com.oracle.truffle.r.test.testrgen.TestrGenBuiltinxtfrmdefault.testxtfrmdefault1 #argv <- structure(list(x = structure(1:3, id = 'An Example', class = structure('numWithId', package = '.GlobalEnv'))), .Names = 'x');do.call('xtfrm.default', argv) [1] 1 2 3 diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/all/AllTests.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/all/AllTests.java index c96933ef5b..fc1b126a4a 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/all/AllTests.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/all/AllTests.java @@ -18425,7 +18425,7 @@ public class AllTests extends TestBase { } @Test - public void TestSimpleDataFrames_testAsDataFrameIgnore_0f990604bed45f9a868ddd4f5616f9ee() { + public void TestSimpleDataFrames_testAsDataFrame_0f990604bed45f9a868ddd4f5616f9ee() { assertEvalError("{ x<-1; class(x)<-\"foo\"; y<-as.data.frame(x) }"); } diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/failing/FailingTests.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/failing/FailingTests.java index fb793ee6b7..cc03a6484c 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/failing/FailingTests.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/failing/FailingTests.java @@ -1305,12 +1305,6 @@ public class FailingTests extends TestBase { check("TestSimpleBuiltins_testUseMethodLocalVars_cd724107886a7c9d25ae3b6aad713cb6"); } - @Test - public void TestSimpleDataFrames_testAsDataFrameIgnore_0f990604bed45f9a868ddd4f5616f9ee() { - assertEvalError("{ x<-1; class(x)<-\"foo\"; y<-as.data.frame(x) }"); - check("TestSimpleDataFrames_testAsDataFrameIgnore_0f990604bed45f9a868ddd4f5616f9ee"); - } - @Test public void TestSimpleFunctions_testDefinitionsIgnore_6ff99329ff4c5405259dd094d456df82() { assertEval("{ x <- function(a,b) { a^b } ; f <- function() { x <- 211 ; sapply(1, x, 2) } ; f() }"); @@ -1797,72 +1791,6 @@ public class FailingTests extends TestBase { check("TestSimpleVectors_testNullUpdate_a2146a5c80766a6d5cc2f40c06202033"); } - @Test - public void TestSimpleVectors_testObjectDirectAccess_01eabfb2c4e15bb5a7006319a4337fd2() { - assertEval("{ x<-factor(c(\"a\", \"b\", \"a\")); `[.factor`(x, 1) }"); - check("TestSimpleVectors_testObjectDirectAccess_01eabfb2c4e15bb5a7006319a4337fd2"); - } - - @Test - public void TestSimpleVectors_testObjectDirectAccess_6f3b4849970406b2315eabe72503d201() { - assertEval("{ x<-factor(c(\"a\", \"b\", \"a\")); `[.factor`(x, 1, drop=TRUE) }"); - check("TestSimpleVectors_testObjectDirectAccess_6f3b4849970406b2315eabe72503d201"); - } - - @Test - public void TestSimpleVectors_testObjectDirectAccess_1be9c6acb933e025c3d74895ff9d7d02() { - assertEval("{ x<-factor(c(\"a\", \"b\", \"a\")); `[.factor`(x, 1, drop=FALSE) }"); - check("TestSimpleVectors_testObjectDirectAccess_1be9c6acb933e025c3d74895ff9d7d02"); - } - - @Test - public void TestSimpleVectors_testObjectDirectAccess_b79b4f8ad5b7cc5a833d720266dd1a1d() { - assertEval("{ x<-factor(c(\"a\", \"b\", \"a\")); `[[.factor`(x, 1) }"); - check("TestSimpleVectors_testObjectDirectAccess_b79b4f8ad5b7cc5a833d720266dd1a1d"); - } - - @Test - public void TestSimpleVectors_testObjectDirectAccess_660880a286cd3118a6c3ffb5f976c827() { - assertEval("{ x<-factor(c(\"a\", z=\"b\", \"a\")); `[[.factor`(x, \"z\") }"); - check("TestSimpleVectors_testObjectDirectAccess_660880a286cd3118a6c3ffb5f976c827"); - } - - @Test - public void TestSimpleVectors_testObjectDirectAccess_c1ed9317efa96b573485632db9fb0241() { - assertEval("{ x<-factor(c(\"a\", zz=\"b\", \"a\")); `[[.factor`(x, \"z\", exact=FALSE) }"); - check("TestSimpleVectors_testObjectDirectAccess_c1ed9317efa96b573485632db9fb0241"); - } - - @Test - public void TestSimpleVectors_testObjectDirectAccess_4833fbe2c62756ace2e149c452458e59() { - assertEval("{ x<-factor(c(\"a\", \"b\", \"a\")); `[`(x, 1) }"); - check("TestSimpleVectors_testObjectDirectAccess_4833fbe2c62756ace2e149c452458e59"); - } - - @Test - public void TestSimpleVectors_testObjectDirectAccess_4eccdd1f73e019373d9d154b833fece5() { - assertEval("{ x<-factor(c(\"a\", \"b\", \"a\")); `[`(x, 1, drop=FALSE) }"); - check("TestSimpleVectors_testObjectDirectAccess_4eccdd1f73e019373d9d154b833fece5"); - } - - @Test - public void TestSimpleVectors_testObjectDirectAccess_945fe85394239f5303dea1a491a918d1() { - assertEval("{ x<-factor(c(\"a\", \"b\", \"a\")); `[[`(x, 1) }"); - check("TestSimpleVectors_testObjectDirectAccess_945fe85394239f5303dea1a491a918d1"); - } - - @Test - public void TestSimpleVectors_testObjectDirectAccess_b51fa52db3d6fc7ed30f6cffba2dadff() { - assertEval("{ x<-factor(c(\"a\", zz=\"b\", \"a\")); `[[`(x, \"z\", exact=FALSE) }"); - check("TestSimpleVectors_testObjectDirectAccess_b51fa52db3d6fc7ed30f6cffba2dadff"); - } - - @Test - public void TestSimpleVectors_testObjectDirectAccess_68b89b4e74c36289fd7aef12dbd3c682() { - assertEvalError("{ x<-factor(c(\"a\", zz=\"b\", \"a\")); `[[.factor`(x, \"z\", exact=TRUE) }"); - check("TestSimpleVectors_testObjectDirectAccess_68b89b4e74c36289fd7aef12dbd3c682"); - } - @Test public void TestSimpleVectors_testScalarIndexIgnored_c5bf8fe63f55705b2cb57df329d3fc2d() { assertEval("{ x<-1:4; x[c(-0.5)] }"); @@ -2379,12 +2307,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinRe_testRe6_cf742d40ae39c895c4709acd08d93023"); } - @Test - public void TestrGenBuiltinReduce_testReduce1_c625550da029520d4fafd5b5027e5da0() { - assertEval("argv <- structure(list(f = '+', x = 1:7, accumulate = TRUE), .Names = c('f', 'x', 'accumulate'));do.call('Reduce', argv)"); - check("TestrGenBuiltinReduce_testReduce1_c625550da029520d4fafd5b5027e5da0"); - } - @Test public void TestrGenBuiltinReduce_testReduce2_68d707d9c4b93d3fb0e16facc6d179cb() { assertEval("argv <- structure(list(f = function(f, ...) f(...), x = list(.Primitive('log'), .Primitive('exp'), .Primitive('acos'), .Primitive('cos')), init = 0, right = TRUE), .Names = c('f', 'x', 'init', 'right'));do.call('Reduce', argv)"); @@ -2703,12 +2625,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinall_testall4_2f46bb1732b004009986f99a5653f807"); } - @Test - public void TestrGenBuiltinallequalPOSIXt_testallequalPOSIXt1_7794d4288c2e86a1333c51371fee2e39() { - assertEval("argv <- structure(list(target = structure(1412833061.16639, class = c('POSIXct', 'POSIXt')), current = structure(1412833061.16839, class = c('POSIXct', 'POSIXt'))), .Names = c('target', 'current'));do.call('all.equal.POSIXt', argv)"); - check("TestrGenBuiltinallequalPOSIXt_testallequalPOSIXt1_7794d4288c2e86a1333c51371fee2e39"); - } - @Test public void TestrGenBuiltinallequalPOSIXt_testallequalPOSIXt2_01a0f550f6faaf9ef6896423d050ba55() { assertEval("argv <- structure(list(target = structure(1412833061.16639, class = c('POSIXct', 'POSIXt')), current = structure(list(sec = 41.1663863658905, min = 37L, hour = 1L, mday = 9L, mon = 9L, year = 114L, wday = 4L, yday = 281L, isdst = 1L, zone = 'EDT', gmtoff = -14400L), .Names = c('sec', 'min', 'hour', 'mday', 'mon', 'year', 'wday', 'yday', 'isdst', 'zone', 'gmtoff'), class = c('POSIXlt', 'POSIXt'), tzone = c('', 'EST', 'EDT'))), .Names = c('target', 'current'));do.call('all.equal.POSIXt', argv)"); @@ -2895,12 +2811,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinaperm_testaperm9_24f3176a36b0c1834e883156b6faf749"); } - @Test - public void TestrGenBuiltinappend_testappend1_88044ff0906016f8294b3bc2e7230739() { - assertEval("argv <- structure(list(x = 1:5, values = 0:1, after = 3), .Names = c('x', 'values', 'after'));do.call('append', argv)"); - check("TestrGenBuiltinappend_testappend1_88044ff0906016f8294b3bc2e7230739"); - } - @Test public void TestrGenBuiltinaregexec_testaregexec1_2f4a7b39aaa55c7bd0f4dd1ce1c70f08() { assertEval("argv <- list('FALSE', 'FALSE', c(0.1, NA, NA, NA, NA), c(1L, 1L, 1L), FALSE, FALSE, FALSE); .Internal(aregexec(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]]))"); @@ -3339,12 +3249,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinascomplex_testascomplex6_6fba59c292c0f19676b228cbf4c35773"); } - @Test - public void TestrGenBuiltinascomplex_testascomplex7_5fe78ce599bd28e6b314c3eca83c918e() { - assertEval("argv <- list(NA_complex_);as.complex(argv[[1]]);"); - check("TestrGenBuiltinascomplex_testascomplex7_5fe78ce599bd28e6b314c3eca83c918e"); - } - @Test public void TestrGenBuiltinasdataframetable_testasdataframetable1_8bbd665649f9d07a7c2d6f8392d71df8() { assertEval("argv <- structure(list(x = structure(integer(0), .Dim = 0L, .Dimnames = structure(list(NULL), .Names = ''), class = 'table')), .Names = 'x');do.call('as.data.frame.table', argv)"); @@ -3507,12 +3411,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinasinteger_testasinteger3_d1dff7e5bb6c4e0191e64cd0294206c7"); } - @Test - public void TestrGenBuiltinasinteger_testasinteger7_9e449efb52d7355d0d205d0c066c6d01() { - assertEval("argv <- list(NULL);as.integer(argv[[1]]);"); - check("TestrGenBuiltinasinteger_testasinteger7_9e449efb52d7355d0d205d0c066c6d01"); - } - @Test public void TestrGenBuiltinasvector_testasvector11_d827720825cadd44936157d0200afa8a() { assertEval("argv <- list(structure(c(0.00290239468554411, 0.00140705152597282, 0.00182415100508824, 0.000171517300342798, 0.0747454613066297, 0.00103234723292905, 0.000179983318697139, 0.035258608446556, 0.00336847595628205, 0.0640696486471418, 0.0132108002751951, 0.00194778778741288, 0.00351950115137134, 0.00070046832029645, 0.00252844357734999, 0.014372012195495, 0.00923422554274329, 7.64817786749709e-06, 0.00387339857745524, 0.00121246491006704, 0.00624917129689857, 0.00187753034805145, 0.000103002251547081, 0.0136703020254034, 0.000349542811339765, 0.00120367047056318, 0.00194205014408536, 0.00462815827742801, 0.000149291834133955, 0.00193441236645678, 9.00084520363788e-05, 0.0160915134527436, 0.00346675958538611, 0.00481936427422656, 3.13343033856204e-05, 0.0564685345533007, 0.00929771993193244, 0.0103876340982415, 0.0133005891226512, 0.0325989357511189, 0.00228122925969392, 0.0460976655088242, 0.00300363745967821, 0.000271060875811077, 0.0301696315261026, 4.72002631048228e-05, 0.0262321004865233, 0.00594174673473013, 0.00288915040856096, 0.00635277836091399, 0.00569342819072193, 0.0163907345734163, 0.000360581939026215, 0.00023772587191537, 0.0164062036225435, 0.0238391417439454, NaN, 0.0421542087325977, 0.00133954856768466, 0.0113421570571088, 0.0081824228772913, 0.000149291834133955, 0.00162069399881579, 0.0018026229128858, 0.0043164627226381, 0.000407784303899559, 0.00876301280354452, 0.00179253664026376, 0.000416739394150718, 0.014372012195495, 0.000179983318697139, 0.00115986529332945, 0.00377736311314377, 0.00219491136307178, 0.00070046832029645, 0.000522557531637993, 9.86336244510646e-05, 0.0216346027446621, 0.000659639144027202, 0.0137501462695058, 5.91425796335962e-08, 0.0279425064631674, 0.000170828237014775, 0.0042454690355613, 0.0114879015536739, 0.000173346990819198, 0.00138111062254461, 0.00772582941114727, 0.0277947034678616, 0.00892024547056825, 0.0618577709874562, 0.0125790610228498, 0.0277947034678616), .Names = c('1', '2', '3', '4', '5', '6', '7', '8', '9', '10', '11', '12', '13', '14', '15', '16', '17', '18', '19', '20', '21', '22', '23', '24', '25', '26', '27', '28', '29', '30', '31', '32', '33', '34', '35', '36', '37', '38', '39', '40', '41', '42', '43', '44', '45', '46', '47', '48', '49', '50', '51', '52', '53', '54', '55', '56', '57', '58', '59', '60', '61', '62', '63', '64', '65', '66', '67', '68', '69', '70', '71', '72', '73', '74', '75', '76', '77', '78', '79', '80', '81', '82', '83', '84', '85', '86', '87', '88', '89', '90', '91', '92', '93')), 'any'); .Internal(as.vector(argv[[1]], argv[[2]]))"); @@ -3585,12 +3483,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinasvector_testasvector32_a21d54f394149e88a72b425a3c0d3e13"); } - @Test - public void TestrGenBuiltinasvector_testasvector33_7f02cce69ded51871ea4562243a768b3() { - assertEval("argv <- list(quote(list(cut(Dtimes, '3 months'))), 'list'); .Internal(as.vector(argv[[1]], argv[[2]]))"); - check("TestrGenBuiltinasvector_testasvector33_7f02cce69ded51871ea4562243a768b3"); - } - @Test public void TestrGenBuiltinasvector_testasvector34_39b5fdb7e9ed8b85f87931734024b0f0() { assertEval("argv <- list(quote(list(a = I('abc'), b = I('def\\'gh'))), 'list'); .Internal(as.vector(argv[[1]], argv[[2]]))"); @@ -3729,12 +3621,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinasvector_testasvector75_8404b961cc1eef89fae8a8981a56db6b"); } - @Test - public void TestrGenBuiltinasvector_testasvector76_82c4e8b63b58404186231e6e216abf15() { - assertEval("argv <- list(structure(list(c0 = structure(character(0), class = 'AsIs')), .Names = 'c0', row.names = character(0), class = 'data.frame'), 'character'); .Internal(as.vector(argv[[1]], argv[[2]]))"); - check("TestrGenBuiltinasvector_testasvector76_82c4e8b63b58404186231e6e216abf15"); - } - @Test public void TestrGenBuiltinasvector_testasvector9_7676f2a631f4a36e921e0abfa4f463f7() { assertEval("argv <- list(quote(list(x = 1:100, z = 1:100 + rnorm(100, 10))), 'list'); .Internal(as.vector(argv[[1]], argv[[2]]))"); @@ -3765,12 +3651,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinatan2_testatan22_68106313fd1758e602266636ed644cf6"); } - @Test - public void TestrGenBuiltinatan2_testatan23_1691a85681428b29f2b8e93909606e43() { - assertEval("argv <- list(c(-1.95681154249341, -2.88854075894443, -2.84850921846233, -2.14635417317387, -1.72790445779804, -0.92649412488672, -0.261537463816701, 0.948205247045638, 1.0990096500205, 2.09024037060933, 2.90928417418961, 4.00425294069879, 1.70515935701163), c(-3.2406391957027, -2.61163262017643, -0.21977838696678, 1.24931893031091, 1.6032898858835, 2.16902716372255, 2.15792786802985, 2.10075226013806, 2.04989923648162, 1.49269068253165, 0.515893014329757, -2.61745072267338, -4.64929811590859)); .Internal(atan2(argv[[1]], argv[[2]]))"); - check("TestrGenBuiltinatan2_testatan23_1691a85681428b29f2b8e93909606e43"); - } - @Test public void TestrGenBuiltinatan2_testatan24_c446d53bd8c4c893f98362165043ce44() { assertEval("argv <- list(0+1i, 0+0i); .Internal(atan2(argv[[1]], argv[[2]]))"); @@ -3783,12 +3663,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinatan2_testatan25_e61d7a90cbac83910e9739b5f4bce322"); } - @Test - public void TestrGenBuiltinatan2_testatan26_2faa23c0efa0572ba47394d813dd43b3() { - assertEval("argv <- list(logical(0), logical(0)); .Internal(atan2(argv[[1]], argv[[2]]))"); - check("TestrGenBuiltinatan2_testatan26_2faa23c0efa0572ba47394d813dd43b3"); - } - @Test public void TestrGenBuiltinatanh_testatanh1_b6e397b36295a6744d6d5a94d225288e() { assertEval("argv <- list(structure(numeric(0), .Dim = c(0L, 0L)));atanh(argv[[1]]);"); @@ -4497,12 +4371,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinceiling_testceiling7_2fb13b9335b8e0692e5224868afa548b"); } - @Test - public void TestrGenBuiltincharToRaw_testcharToRaw1_f6ac05ee10c8b34d9c24558aed17abd0() { - assertEval("argv <- list(''); .Internal(charToRaw(argv[[1]]))"); - check("TestrGenBuiltincharToRaw_testcharToRaw1_f6ac05ee10c8b34d9c24558aed17abd0"); - } - @Test public void TestrGenBuiltinchartr_testchartr1_9279f1e8c0c7e17436b2b5348cb0e604() { assertEval("argv <- list('.', '.', c('0.02', '0.06', '0.11', '0.22', '0.56', '1.1')); .Internal(chartr(argv[[1]], argv[[2]], argv[[3]]))"); @@ -5991,12 +5859,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinenvironmentassign_testenvironmentassign1_e7d1897ac0f6b1cd0f4b3d8d7187eec3"); } - @Test - public void TestrGenBuiltinexists_testexists1_f048c8e191a9ca92fa7722dee8ade8e2() { - assertEval("argv <- structure(list(x = '.Device'), .Names = 'x');do.call('exists', argv)"); - check("TestrGenBuiltinexists_testexists1_f048c8e191a9ca92fa7722dee8ade8e2"); - } - @Test public void TestrGenBuiltinexp_testexp10_37d07ab33adb8aa318383f2302accf5f() { assertEval("argv <- list(c(47.5645940356179, -6.38155741912049, -4.72835558025993, -9.12276173822938, 16.7269898773273, 1.72738845624351, 2.57214256243276, -6.38155741912049, 54.3235157345705, -1.01577550708815, 1.03229146110395, -7.85550713095368, -0.907238963715769, -0.92327375484205, -4.72835558025993, -1.01577550708815, 46.5450612116912, 4.59443066488959, -2.69397762349353, -13.3238428844397, -4.89920529326131, -9.12276173822938, 1.03229146110395, 4.59443066488959, 47.7416929123262, -3.84567249122941, -9.99434616922533, -0.0518296900644576, 16.7269898773273, -7.85550713095368, -2.69397762349353, -3.84567249122941, 49.4381847193856, 8.76151535039852, 0.371991514317358, 1.72738845624351, -0.907238963715769, -13.3238428844397, -9.99434616922533, 8.76151535039852, 50.1823716395239, -1.41801229530673, 2.57214256243276, -0.92327375484205, -4.89920529326131, -0.0518296900644576, 0.371991514317358, -1.41801229530673, 44.6019728197531));exp(argv[[1]]);"); @@ -6069,12 +5931,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinextract_parentasis_Date_testextract_parentasis_Date1_677d86047a9393cde9cd22b1445e80b5"); } - @Test - public void TestrGenBuiltinextract_parentasis_assign_factor_testextract_parentasis_assign_factor1_6ab7f28cbfdde795b5454d7c3e767116() { - assertEval("argv <- structure(list(x = structure(c(4L, 1L, 4L, 4L, 6L, 4L, 5L, 5L, 4L, 6L, 6L, 2L, 3L, 6L, 4L, 2L, 1L, 6L, 1L, 3L, 3L, 5L, 2L, 2L, 2L, 5L, 3L, 3L, 1L, 2L, 5L, 6L, 6L, 6L, 6L, 2L, 6L, 1L, 5L, 1L, 2L, 4L, 4L, 6L, 5L, 5L, 2L, 6L, 4L, 6L, 5L, 1L, 2L, 5L, 1L, 1L, 4L, 3L, 3L, 4L, 4L, 2L, 5L, 3L, 4L, 5L, 4L, 6L, 4L, 5L, 2L, 6L, 2L, 4L, 2L, 2L, 4L, 4L, 1L, 6L, 2L, 1L, 5L, 3L, 5L, 1L, 2L, 2L, 4L, 2L, 4L, 2L, 5L, 6L, 5L, 6L, 3L, 1L, 2L, 4L, 6L, 6L, 3L, 3L, 2L, 6L, 2L, 5L, 3L, 4L, 3L, 4L, 6L, 3L, 4L, 2L, 3L, 1L, 6L, 2L, 4L, 4L, 1L, 3L, 4L, 3L, 4L, 1L, 4L, 1L, 3L, 5L, 5L, 5L, 4L, 4L, 6L, 2L, 6L, 3L, 2L, 1L, 1L, 6L, 2L, 2L, 5L, 1L, 5L, 3L, 2L, 2L, 5L, 1L, 6L, 3L, 6L, 4L, 2L, 2L, 5L, 6L, 6L, 1L, 1L, 6L, 6L, 5L, 2L, 5L, 6L, 5L, 4L, 6L, 2L, 5L, 4L, 3L, 5L, 1L, 3L, 4L, 4L, 3L, 1L, 1L, 5L, 4L, 1L, 3L, 5L, 4L, 5L, 4L, 6L, 6L, 2L, 4L, 3L, 3L), .Label = c('a', 'b', 'c', 'd', 'e', 'f'), class = 'factor'), c(189L, 84L, 154L, 9L, 130L, 44L, 137L, 12L, 50L, 1L, 42L, 174L, 194L, 131L, 157L, 101L, 37L, 128L, 117L, 181L, 51L, 109L, 110L, 67L, 69L, 124L, 192L, 65L, 171L, 168L), value = NA), .Names = c('x', '', 'value'));do.call('[<-.factor', argv)"); - check("TestrGenBuiltinextract_parentasis_assign_factor_testextract_parentasis_assign_factor1_6ab7f28cbfdde795b5454d7c3e767116"); - } - @Test public void TestrGenBuiltinextract_parentasis_dataframe_testextract_parentasis_dataframe1_b62183b96921d7174a56f16f6dc89057() { assertEval("argv <- structure(list(x = structure(list(ID = c(13, 41, 121, 202, 247, 292, 415, 492), Location = c(0.15998329123474, 0.533277637449134, 1.5998329123474, 2.6797201281819, 3.27965747031217, 3.87959481244245, 5.51942354759854, 6.54598299968812), Peak_Value = c(0.997547264684804, 0.949162789397664, 0.990440013891923, 0.973478735915337, 0.93861267739627, 0.957347289323235, 0.924803043529451, 0.968307855031101)), .Names = c('ID', 'Location', 'Peak_Value'), row.names = c(NA, -8L), class = 'data.frame'), i = 2), .Names = c('x', 'i'));do.call('[.data.frame', argv)"); @@ -6087,12 +5943,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinextract_parentasis_dataframe_testextract_parentasis_dataframe2_5a2ab0c147f4f04db1c0405c273b36bf"); } - @Test - public void TestrGenBuiltinextract_parentasis_extract_parentasis_assign_factor_testextract_parentasis_extract_parentasis_assign_factor1_5605f01dadc0e5f8b00b150f5ce0d8fd() { - assertEval("argv <- structure(list(x = structure(c(2L, 2L, 3L), .Label = c('One', 'Two', 'Three'), class = 'factor'), 2, value = 'One'), .Names = c('x', '', 'value'));do.call('[[<-.factor', argv)"); - check("TestrGenBuiltinextract_parentasis_extract_parentasis_assign_factor_testextract_parentasis_extract_parentasis_assign_factor1_5605f01dadc0e5f8b00b150f5ce0d8fd"); - } - @Test public void TestrGenBuiltinextract_parentasis_extract_parentasis_factor_testextract_parentasis_extract_parentasis_factor1_5fced93c42220fd5b3326690c2f82d6b() { assertEval("argv <- structure(list(x = structure(2:4, .Label = c('A', 'B', 'C', 'D', 'E'), class = 'factor'), 2), .Names = c('x', ''));do.call('[[.factor', argv)"); @@ -6921,24 +6771,12 @@ public class FailingTests extends TestBase { check("TestrGenBuiltingsub_testgsub23_c827d7a2b0952230ea4e05cad718f20b"); } - @Test - public void TestrGenBuiltingsub_testgsub25_e759254c5e5d6da45f534f8e03283b99() { - assertEval("argv <- list('%', '\\\\\\\\%', structure('foo', .Names = 'object'), FALSE, FALSE, FALSE, FALSE); .Internal(gsub(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]]))"); - check("TestrGenBuiltingsub_testgsub25_e759254c5e5d6da45f534f8e03283b99"); - } - @Test public void TestrGenBuiltingsub_testgsub26_a6631bc9f1b0c1f13b46d61f09bc359e() { assertEval("argv <- list('\\\\\\\\(l|)dots', '...', structure('plot(1:10, 1:10, main = \\'text(...) examples\\\\n~~~~~~~~~~~~~~\\',\\n', Rd_tag = 'RCODE'), FALSE, TRUE, FALSE, TRUE); .Internal(gsub(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]]))"); check("TestrGenBuiltingsub_testgsub26_a6631bc9f1b0c1f13b46d61f09bc359e"); } - @Test - public void TestrGenBuiltingsub_testgsub27_abf221cb6ca381e202b1dd98ead58967() { - assertEval("argv <- list('.__T__(.*):([^:]+(.*))', '\\\\2', c('.__T__!:base', '.__T__%%:base', '.__T__%*%:base', '.__T__%/%:base', '.__T__&:base', '.__T__*:base', '.__T__+:base', '.__T__-:base', '.__T__/:base', '.__T__Arith:base', '.__T__BunchKaufman:Matrix', '.__T__Cholesky:Matrix', '.__T__Compare:methods', '.__T__Logic:base', '.__T__Math2:methods', '.__T__Math:base', '.__T__Ops:base', '.__T__Schur:Matrix', '.__T__Summary:base', '.__T__[:base', '.__T__[<-:base', '.__T__^:base', '.__T__all.equal:base', '.__T__all:base', '.__T__any:base', '.__T__as.array:base', '.__T__as.integer:base', '.__T__as.logical:base', '.__T__as.matrix:base', '.__T__as.numeric:base', '.__T__as.vector:base', '.__T__band:Matrix', '.__T__cbind2:methods', '.__T__chol2inv:base', '.__T__chol:base', '.__T__coerce:methods', '.__T__coerce<-:methods', '.__T__colMeans:base', '.__T__colSums:base', '.__T__cov2cor:stats', '.__T__crossprod:base', '.__T__determinant:base', '.__T__diag:base', '.__T__diag<-:base', '.__T__diff:base', '.__T__dim:base', '.__T__dim<-:base', '.__T__dimnames:base', '.__T__dimnames<-:base', '.__T__drop:base', '.__T__expand:Matrix', '.__T__expm:Matrix', '.__T__facmul:Matrix', '.__T__forceSymmetric:Matrix', '.__T__format:base', '.__T__head:utils', '.__T__image:graphics', '.__T__initialize:methods', '.__T__is.finite:base', '.__T__is.infinite:base', '.__T__is.na:base', '.__T__isDiagonal:Matrix', '.__T__isSymmetric:base', '.__T__isTriangular:Matrix', '.__T__kronecker:base', '.__T__length:base', '.__T__lu:Matrix', '.__T__mean:base', '.__T__nnzero:Matrix', '.__T__norm:base', '.__T__pack:Matrix', '.__T__print:base', '.__T__prod:base', '.__T__qr.Q:base', '.__T__qr.R:base', '.__T__qr.coef:base', '.__T__qr.fitted:base', '.__T__qr.qty:base', '.__T__qr.qy:base', '.__T__qr.resid:base', '.__T__qr:base', '.__T__rbind2:methods', '.__T__rcond:base', '.__T__rep:base', '.__T__rowMeans:base', '.__T__rowSums:base', '.__T__show:methods', '.__T__skewpart:Matrix', '.__T__solve:base', '.__T__sum:base', '.__T__summary:base', '.__T__symmpart:Matrix', '.__T__t:base', '.__T__tail:utils', '.__T__tcrossprod:base', '.__T__toeplitz:stats', '.__T__tril:Matrix', '.__T__triu:Matrix', '.__T__unname:base', '.__T__unpack:Matrix', '.__T__update:stats', '.__T__updown:Matrix', '.__T__which:base', '.__T__writeMM:Matrix', '.__T__zapsmall:base'), FALSE, FALSE, FALSE, FALSE); .Internal(gsub(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]]))"); - check("TestrGenBuiltingsub_testgsub27_abf221cb6ca381e202b1dd98ead58967"); - } - @Test public void TestrGenBuiltingsub_testgsub28_2786109e8ceb268fe75e04680d783361() { assertEval("argv <- list('([^\\\\])\\\\(', '\\\\1\\\\\\\\(', '^.*{n.*$', FALSE, FALSE, FALSE, FALSE); .Internal(gsub(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]]))"); @@ -7257,12 +7095,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltiniscall_testiscall26_753ff719553b6809d09c4ecb670b117d"); } - @Test - public void TestrGenBuiltiniscomplex_testiscomplex4_7f99f72176d8256c0360850982256f99() { - assertEval("argv <- list(NA_complex_);is.complex(argv[[1]]);"); - check("TestrGenBuiltiniscomplex_testiscomplex4_7f99f72176d8256c0360850982256f99"); - } - @Test public void TestrGenBuiltinisfinite_testisfinite10_a54ba2260a5c0bbf3588f18e608b5096() { assertEval("argv <- list(structure(c(-32.6915744137254, -24.6945405669482, -24.6945405669482, -357.79068676373), .Dim = c(2L, 2L)));is.finite(argv[[1]]);"); @@ -7713,12 +7545,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinisna_testisna34_e26dee73698813118118fe9b6a849231"); } - @Test - public void TestrGenBuiltinisna_testisna35_3a958646dfd6addce10492f5e23b6947() { - assertEval("argv <- list(NA_complex_);is.na(argv[[1]]);"); - check("TestrGenBuiltinisna_testisna35_3a958646dfd6addce10492f5e23b6947"); - } - @Test public void TestrGenBuiltinisna_testisna37_1dee0e5e27f42092b55314e66ddc2e5c() { assertEval("argv <- list(structure(list(sec = 40, min = 24L, hour = 11L, mday = 15L, mon = 11L, year = 100L, wday = 5L, yday = 349L, isdst = 0L), .Names = c('sec', 'min', 'hour', 'mday', 'mon', 'year', 'wday', 'yday', 'isdst'), class = c('POSIXlt', 'POSIXt')));is.na(argv[[1]]);"); @@ -7803,12 +7629,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinisnan_testisnan9_2b940567bf3f4e734a1a778e1edea354"); } - @Test - public void TestrGenBuiltinisnull_testisnull14_50434f5c1b341684b0b42a3e1175c33d() { - assertEval("argv <- list(NA_complex_);do.call('is.null', argv)"); - check("TestrGenBuiltinisnull_testisnull14_50434f5c1b341684b0b42a3e1175c33d"); - } - @Test public void TestrGenBuiltinisnull_testisnull16_6aed923cc68e227d5514bf5a366ffbb7() { assertEval("argv <- list(function(file = ifelse(onefile, 'Rplots.pdf', 'Rplot%03d.pdf'), width, height, onefile, family, title, fonts, version, paper, encoding, bg, fg, pointsize, pagecentre, colormodel, useDingbats, useKerning, fillOddEven, compress) { initPSandPDFfonts() new <- list() if (!missing(width)) new$width <- width if (!missing(height)) new$height <- height if (!missing(onefile)) new$onefile <- onefile if (!missing(title)) new$title <- title if (!missing(fonts)) new$fonts <- fonts if (!missing(version)) new$version <- version if (!missing(paper)) new$paper <- paper if (!missing(encoding)) new$encoding <- encoding if (!missing(bg)) new$bg <- bg if (!missing(fg)) new$fg <- fg if (!missing(pointsize)) new$pointsize <- pointsize if (!missing(pagecentre)) new$pagecentre <- pagecentre if (!missing(colormodel)) new$colormodel <- colormodel if (!missing(useDingbats)) new$useDingbats <- useDingbats if (!missing(useKerning)) new$useKerning <- useKerning if (!missing(fillOddEven)) new$fillOddEven <- fillOddEven if (!missing(compress)) new$compress <- compress old <- check.options(new, name.opt = '.PDF.Options', envir = .PSenv) if (!missing(family) && (inherits(family, 'Type1Font') || inherits(family, 'CIDFont'))) { enc <- family$encoding if (inherits(family, 'Type1Font') && !is.null(enc) && enc != 'default' && (is.null(old$encoding) || old$encoding == 'default')) old$encoding <- enc family <- family$metrics } if (is.null(old$encoding) || old$encoding == 'default') old$encoding <- guessEncoding() if (!missing(family)) { if (length(family) == 4L) { family <- c(family, 'Symbol.afm') } else if (length(family) == 5L) { } else if (length(family) == 1L) { pf <- pdfFonts(family)[[1L]] if (is.null(pf)) stop(gettextf('unknown family '%s'', family), domain = NA) matchFont(pf, old$encoding) } else stop('invalid 'family' argument') old$family <- family } version <- old$version versions <- c('1.1', '1.2', '1.3', '1.4', '1.5', '1.6', '1.7', '2.0') if (version %in% versions) version <- as.integer(strsplit(version, '[.]')[[1L]]) else stop('invalid PDF version') onefile <- old$onefile if (!checkIntFormat(file)) stop(gettextf('invalid 'file' argument '%s'', file), domain = NA) .External(C_PDF, file, old$paper, old$family, old$encoding, old$bg, old$fg, old$width, old$height, old$pointsize, onefile, old$pagecentre, old$title, old$fonts, version[1L], version[2L], old$colormodel, old$useDingbats, old$useKerning, old$fillOddEven, old$compress) invisible()});do.call('is.null', argv)"); @@ -7863,12 +7683,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinjulianDate_testjulianDate1_e2611ffbc0bb4eb7d2e9db89106c26d1"); } - @Test - public void TestrGenBuiltinlabels_testlabels1_9429b8f435fb4d93c055e4d34115a4bb() { - assertEval("argv <- structure(list(object = structure(c(-469.098459411633, 469.356672501203, -0.429918004252249, 0.00364370239091614, -0.256875513692359, -0.0204799335117722, 2.00613934942808), .Names = c('(Intercept)', 'gravity', 'ph', 'osmo', 'conduct', 'urea', 'log(calc)'))), .Names = 'object');do.call('labels', argv)"); - check("TestrGenBuiltinlabels_testlabels1_9429b8f435fb4d93c055e4d34115a4bb"); - } - @Test public void TestrGenBuiltinlazyLoadDBflush_testlazyLoadDBflush1_cef4a1af4e9fa39cdf8f736e988487cd() { assertEval("argv <- list('/home/roman/r-instrumented/library/tools/R/tools.rdb'); .Internal(lazyLoadDBflush(argv[[1]]))"); @@ -8433,12 +8247,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinmatrix_testmatrix25_02c656525f8d9af8a83980a72d34fb51"); } - @Test - public void TestrGenBuiltinmatrix_testmatrix28_41e0446a1e0ca65f255d4d46f04b6f03() { - assertEval("argv <- list(NA_complex_, 5L, 1L, FALSE, NULL, FALSE, FALSE); .Internal(matrix(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]]))"); - check("TestrGenBuiltinmatrix_testmatrix28_41e0446a1e0ca65f255d4d46f04b6f03"); - } - @Test public void TestrGenBuiltinmatrix_testmatrix29_eb80b03f9fa1526f108b3e3ab317fd08() { assertEval("argv <- list(NA_character_, 4L, 17L, FALSE, NULL, FALSE, FALSE); .Internal(matrix(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]]))"); @@ -8571,12 +8379,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinmean_testmean17_3ff1f045467adce67fbf87c1dec8e1f2"); } - @Test - public void TestrGenBuiltinmean_testmean19_6620b77cdd646a0c73fb0012b5450b0f() { - assertEval("argv <- structure(list(x = structure(c(31, NA, NA, 31), units = 'days', class = 'difftime'), na.rm = TRUE), .Names = c('x', 'na.rm'));do.call('mean', argv)"); - check("TestrGenBuiltinmean_testmean19_6620b77cdd646a0c73fb0012b5450b0f"); - } - @Test public void TestrGenBuiltinmean_testmean2_5b80432d7da7d000026ef5f85256359c() { assertEval("argv <- list(c(0.104166666666667, 0.285714285714286, 0.285714285714286, NA)); .Internal(mean(argv[[1]]))"); @@ -8889,12 +8691,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinoperators_testoperators109_92586c40bacb2026c7d5368eaee757ed"); } - @Test - public void TestrGenBuiltinoperators_testoperators110_5e09a2dbdb2811ad41daadd0ac7279bd() { - assertEval("argv <- list(structure(list(Fertility = c(80.2, 83.1, 92.5, 85.8, 76.9), Agriculture = c(17, 45.1, 39.7, 36.5, 43.5), Examination = c(15L, 6L, 5L, 12L, 17L), Education = c(12L, 9L, 5L, 7L, 15L)), .Names = c('Fertility', 'Agriculture', 'Examination', 'Education'), row.names = c('Courtelary', 'Delemont', 'Franches-Mnt', 'Moutier', 'Neuveville'), class = 'data.frame'), 6);`<=`(argv[[1]],argv[[2]]);"); - check("TestrGenBuiltinoperators_testoperators110_5e09a2dbdb2811ad41daadd0ac7279bd"); - } - @Test public void TestrGenBuiltinoperators_testoperators112_3963dd31b169d53844495e248c650658() { assertEval("argv <- list(structure(integer(0), .Label = character(0), class = 'factor'));`!`(argv[[1]]);"); @@ -8925,12 +8721,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinoperators_testoperators120_571abbafc889c01f539529e23ed0df5e"); } - @Test - public void TestrGenBuiltinoperators_testoperators126_b247bd4cada9ea987df987f69c0254ca() { - assertEval("argv <- list(structure(list(cde = 2L, cd = 4L), .Names = c('cde', 'cd'), row.names = 'ab', class = 'data.frame'), c(2, 4));`==`(argv[[1]],argv[[2]]);"); - check("TestrGenBuiltinoperators_testoperators126_b247bd4cada9ea987df987f69c0254ca"); - } - @Test public void TestrGenBuiltinoperators_testoperators130_3c02add1a8cf420daac6027427811d6e() { assertEval("argv <- list(2, structure(list(2L), class = structure('L', package = '.GlobalEnv')));`==`(argv[[1]],argv[[2]]);"); @@ -9069,12 +8859,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinoperators_testoperators19_35579b6bb06ebf62a6bd7cd24bb396bb"); } - @Test - public void TestrGenBuiltinoperators_testoperators192_aa8cb7d7de7b90b7539ec5efc857a229() { - assertEval("argv <- list(structure(c(TRUE, FALSE, FALSE, FALSE, FALSE, TRUE, TRUE, TRUE, TRUE, NA), .Dim = c(5L, 2L), .Dimnames = list(NULL, c('VAR1', 'VAR3'))), structure(c(TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, FALSE), .Dim = c(5L, 2L), .Dimnames = list(NULL, c('VAR1', 'VAR3'))));`&`(argv[[1]],argv[[2]]);"); - check("TestrGenBuiltinoperators_testoperators192_aa8cb7d7de7b90b7539ec5efc857a229"); - } - @Test public void TestrGenBuiltinoperators_testoperators195_1f782bffbabe014b420a84d687c86893() { assertEval("argv <- list(7);`(`(argv[[1]]);"); @@ -9291,12 +9075,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinoperators_testoperators26_afc6633c2f1cbf34a1ded26bfdb5f905"); } - @Test - public void TestrGenBuiltinoperators_testoperators261_cba752dcaf75cdd4235e6d15b592d9fa() { - assertEval("argv <- list(structure(list(VAR1 = c(1, 2, 3, 4, 5), VAR3 = c(1, 1, 1, 1, NA)), .Names = c('VAR1', 'VAR3'), class = 'data.frame', row.names = c(NA, -5L)), 1);`==`(argv[[1]],argv[[2]]);"); - check("TestrGenBuiltinoperators_testoperators261_cba752dcaf75cdd4235e6d15b592d9fa"); - } - @Test public void TestrGenBuiltinoperators_testoperators272_b8f9baa9b9d7a0fe22ff221de6356d02() { assertEval("argv <- list(structure(c(4, 3, 2, 1, 0), .Tsp = c(-1, 3, 1), class = 'ts'), 1e-05);`>`(argv[[1]],argv[[2]]);"); @@ -9405,12 +9183,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinoperators_testoperators312_f0e28dda5fd6a79f4fce4f88da41e681"); } - @Test - public void TestrGenBuiltinoperators_testoperators313_752d12f515bacd25ca236c8fb4b76e1f() { - assertEval("argv <- list(structure(c(NA, FALSE, TRUE, NA, FALSE, TRUE, NA, FALSE, TRUE), .Names = c(NA, 'FALSE', 'TRUE', NA, 'FALSE', 'TRUE', NA, 'FALSE', 'TRUE')), structure(c(NA, NA, NA, FALSE, FALSE, FALSE, TRUE, TRUE, TRUE), .Names = c(NA, NA, NA, 'FALSE', 'FALSE', 'FALSE', 'TRUE', 'TRUE', 'TRUE')));`|`(argv[[1]],argv[[2]]);"); - check("TestrGenBuiltinoperators_testoperators313_752d12f515bacd25ca236c8fb4b76e1f"); - } - @Test public void TestrGenBuiltinoperators_testoperators314_9be667d83c3750672072fb07114a3b67() { assertEval("argv <- list(structure(120L, class = 'octmode'), '644');`|`(argv[[1]],argv[[2]]);"); @@ -9501,12 +9273,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinoperators_testoperators336_84591dff930b3cd2863d554b6e159dc8"); } - @Test - public void TestrGenBuiltinoperators_testoperators337_0a2327b7e83d6accfbb3a38e14d5e48a() { - assertEval("argv <- list(c(TRUE, TRUE, TRUE, FALSE, TRUE, TRUE, TRUE, FALSE), c(TRUE, TRUE, TRUE, NA, FALSE, FALSE, TRUE, NA));`&`(argv[[1]],argv[[2]]);"); - check("TestrGenBuiltinoperators_testoperators337_0a2327b7e83d6accfbb3a38e14d5e48a"); - } - @Test public void TestrGenBuiltinoperators_testoperators34_a9431d2364dde2ac140f6f17c920c1ad() { assertEval("argv <- list(structure(list(c0 = structure(integer(0), .Label = character(0), class = 'factor')), .Names = 'c0', row.names = character(0), class = 'data.frame'), structure(list(c0 = structure(integer(0), .Label = character(0), class = 'factor')), .Names = 'c0', row.names = character(0), class = 'data.frame'));`+`(argv[[1]],argv[[2]]);"); @@ -9525,12 +9291,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinoperators_testoperators341_7aebbf647e9c2fe68e5efbab86240d11"); } - @Test - public void TestrGenBuiltinoperators_testoperators342_21dec62d790ce46198eed22072f9caab() { - assertEval("argv <- list(structure(c(NA, FALSE, TRUE, NA, FALSE, TRUE, NA, FALSE, TRUE), .Names = c(NA, 'FALSE', 'TRUE', NA, 'FALSE', 'TRUE', NA, 'FALSE', 'TRUE')), structure(c(NA, NA, NA, FALSE, FALSE, FALSE, TRUE, TRUE, TRUE), .Names = c(NA, NA, NA, 'FALSE', 'FALSE', 'FALSE', 'TRUE', 'TRUE', 'TRUE')));`&`(argv[[1]],argv[[2]]);"); - check("TestrGenBuiltinoperators_testoperators342_21dec62d790ce46198eed22072f9caab"); - } - @Test public void TestrGenBuiltinoperators_testoperators343_3d4847ee88a4b4979dc54cafab35e84a() { assertEval("argv <- list(structure(508L, class = 'octmode'), '755');`&`(argv[[1]],argv[[2]]);"); @@ -9723,12 +9483,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinoperators_testoperators50_30436ed25394cd65c2763b6febb31068"); } - @Test - public void TestrGenBuiltinoperators_testoperators51_67e818b19655041f681c5fe551540318() { - assertEval("argv <- list(structure(c(94694400, 126230400, 157766400, 189302400, 220924800, 252460800, 283996800, 315532800, 362793600, 394329600, 425865600, 489024000, 567993600, 631152000, 662688000, 709948800, 741484800, 773020800, 820454400, 867715200, 915148800, 1136073600, 1230768000, 1341100800), class = c('POSIXct', 'POSIXt')), structure(c(78796800, 94694400, 126230400, 157766400, 189302400, 220924800, 252460800, 283996800, 315532800, 362793600, 394329600, 425865600, 489024000, 567993600, 631152000, 662688000, 709948800, 741484800, 773020800, 820454400, 867715200, 1136073600, 1230768000, 1341100800), class = c('POSIXct', 'POSIXt')));`-`(argv[[1]],argv[[2]]);"); - check("TestrGenBuiltinoperators_testoperators51_67e818b19655041f681c5fe551540318"); - } - @Test public void TestrGenBuiltinoperators_testoperators52_0ae639664f63b4b213e6235475e82a0a() { assertEval("argv <- list(structure(c(9, 12, 12, 15, 9, 9, 13, 11, 15, 10, 13, 13, 13, 15, 8, 13, 13, 10, 7, 9, 6, 11, 3, 5, 9, 3, 5, 1, 1, 2, NA, 10, 1, 4, 7, 4, NA, NA, 5, 2, 4, 3, 3, 6, 1, 1, 63, 41, 59, 50, 290, 226, 60, 36, 32, 121, 70, 51, 79, 32, 42, 39, 76, 60, 56, 88, 57, 309, 254, 146, 43, 78, 88, 314, 149, 78, NA, 238, 153, 159, 222, 203, NA, NA, 74, 100, 111, 9, 180, 50, 256, 107), .Dim = c(23L, 4L), .Dimnames = list(NULL, c('V1', 'V2', 'V3', 'V4'))), structure(c(10.8260869565217, 10.8260869565217, 10.8260869565217, 10.8260869565217, 10.8260869565217, 10.8260869565217, 10.8260869565217, 10.8260869565217, 10.8260869565217, 10.8260869565217, 10.8260869565217, 10.8260869565217, 10.8260869565217, 10.8260869565217, 10.8260869565217, 10.8260869565217, 10.8260869565217, 10.8260869565217, 10.8260869565217, 10.8260869565217, 10.8260869565217, 10.8260869565217, 10.8260869565217, 3.85, 3.85, 3.85, 3.85, 3.85, 3.85, 3.85, 3.85, 3.85, 3.85, 3.85, 3.85, 3.85, 3.85, 3.85, 3.85, 3.85, 3.85, 3.85, 3.85, 3.85, 3.85, 3.85, 95.2608695652174, 95.2608695652174, 95.2608695652174, 95.2608695652174, 95.2608695652174, 95.2608695652174, 95.2608695652174, 95.2608695652174, 95.2608695652174, 95.2608695652174, 95.2608695652174, 95.2608695652174, 95.2608695652174, 95.2608695652174, 95.2608695652174, 95.2608695652174, 95.2608695652174, 95.2608695652174, 95.2608695652174, 95.2608695652174, 95.2608695652174, 95.2608695652174, 95.2608695652174, 137.9, 137.9, 137.9, 137.9, 137.9, 137.9, 137.9, 137.9, 137.9, 137.9, 137.9, 137.9, 137.9, 137.9, 137.9, 137.9, 137.9, 137.9, 137.9, 137.9, 137.9, 137.9, 137.9), .Dim = c(23L, 4L)));`-`(argv[[1]],argv[[2]]);"); @@ -9753,12 +9507,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinoperators_testoperators58_db0f2e287893afc566c292115e43b72c"); } - @Test - public void TestrGenBuiltinoperators_testoperators63_3284f8169b83e55f63c16b6a572bf1b4() { - assertEval("argv <- list(structure(list(war = c(1L, 1L, 2L, 1L, 2L, 2L, 2L, 2L, 2L, 1L, 1L, 1L, 2L, 1L, 1L, 2L, 2L, 1L, 1L, 2L), fly = c(1L, 2L, 1L, 1L, 1L, 1L, 2L, 2L, 1L, 2L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L), ver = c(1L, 1L, 2L, 1L, 2L, 2L, 2L, 2L, 2L, 1L, 2L, 2L, 2L, 2L, 1L, 2L, 2L, 2L, 1L, 2L), end = c(1L, 1L, 1L, 1L, 2L, 1L, 1L, 2L, 2L, 1L, 2L, 1L, NA, 1L, 1L, 2L, 1L, 1L, NA, 2L), gro = c(2L, 2L, 1L, 1L, 2L, 2L, 2L, 1L, 2L, 1L, NA, 2L, 2L, 1L, NA, 2L, 2L, NA, 1L, 2L), hai = c(1L, 2L, 2L, 2L, 2L, 2L, 1L, 1L, 1L, 1L, 1L, 1L, 2L, 1L, 1L, 2L, 2L, 1L, 2L, 1L)), .Names = c('war', 'fly', 'ver', 'end', 'gro', 'hai'), class = 'data.frame', row.names = c('ant', 'bee', 'cat', 'cpl', 'chi', 'cow', 'duc', 'eag', 'ele', 'fly', 'fro', 'her', 'lio', 'liz', 'lob', 'man', 'rab', 'sal', 'spi', 'wha')), 1);`-`(argv[[1]],argv[[2]]);"); - check("TestrGenBuiltinoperators_testoperators63_3284f8169b83e55f63c16b6a572bf1b4"); - } - @Test public void TestrGenBuiltinoperators_testoperators64_529a2b478d936e5c96057f626febbb41() { assertEval("argv <- list(structure(integer(0), .Label = character(0), class = 'factor'));`-`(argv[[1]]);"); @@ -10083,12 +9831,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinprintfunction_testprintfunction3_dab1c69d5d496ff15cb56eb6d8a68170"); } - @Test - public void TestrGenBuiltinprintfunction_testprintfunction4_e6dc900fb27246048b43ec42f83eb5d0() { - assertEval("argv <- list(.Primitive('.Internal'), TRUE); .Internal(print.function(argv[[1]], argv[[2]]))"); - check("TestrGenBuiltinprintfunction_testprintfunction4_e6dc900fb27246048b43ec42f83eb5d0"); - } - @Test public void TestrGenBuiltinprintfunction_testprintfunction5_6be715f4c61b9c874a7c0f88aec283b5() { assertEval("argv <- list(.Primitive('log'), TRUE); .Internal(print.function(argv[[1]], argv[[2]]))"); @@ -10917,12 +10659,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinsep_testsep13_3feeb0a231d4f13d3f69b87b6efe3590"); } - @Test - public void TestrGenBuiltinsep_testsep14_65c05ddeeafeda38f6377c0a4512aa3a() { - assertEval("argv <- list(structure(list(A = c(52L, 52L, 47L, 45L, 40L, 37L, 27L, 27L, 23L, 22L, 21L, 25L, 24L, 22L, 22L, 20L, 16L, 17L, 14L, 13L, 13L, 14L, 24L), F = c(42L, 44L, 48L, 49L, 50L, 54L, 58L, 54L, 59L, 59L, 60L, 53L, 54L, 55L, 56L, 58L, 62L, 57L, 54L, 55L, 52L, 47L, 56L), M = c(6L, 4L, 5L, 6L, 10L, 9L, 15L, 19L, 18L, 19L, 19L, 22L, 22L, 23L, 22L, 22L, 22L, 26L, 32L, 32L, 35L, 39L, 20L)), .Names = c('A', 'F', 'M'), class = 'data.frame', row.names = c(NA, 23L)), 100);`/`(argv[[1]],argv[[2]]);"); - check("TestrGenBuiltinsep_testsep14_65c05ddeeafeda38f6377c0a4512aa3a"); - } - @Test public void TestrGenBuiltinsep_testsep16_04768845c16f7d46591acb6c2369960d() { assertEval("argv <- list(structure(c(126.49966838981, 123.340306958365, 124.994330270046, 129.001056705356, 131.639025779016, 124.408594738421, 125.475982014377, 125.929559340094, 126.630542479839, 127.249057014908, 127.661400038288, 128.403617480371, 129.888052364537, 131.702361667407, 133.516670970277, 135.001105854443, 135.990729110554, 137.310226785368, 144.127817178676, 144.648818160919, 147.114894939813, 142.21953431078, 139.936534657354, 152.343274976711), .Tsp = c(1949, 1950.91666666667, 12), class = 'ts'), structure(c(NA, NA, NA, NA, NA, NA, 126.791666666667, 127.25, 127.958333333333, 128.583333333333, 129, 129.75, 131.25, 133.083333333333, 134.916666666667, 136.416666666667, 137.416666666667, 138.75, NA, NA, NA, NA, NA, NA), .Tsp = c(1949, 1950.91666666667, 12), class = 'ts'));`/`(argv[[1]],argv[[2]]);"); @@ -11373,24 +11109,12 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinsinh_testsinh2_0805f93651aa105e4f0b268d3355b3c5"); } - @Test - public void TestrGenBuiltinsink_testsink1_1f2f54c86246d0e139afd22163c76df3() { - assertEval("argv <- list(structure(2L, class = c('terminal', 'connection')), FALSE, TRUE, FALSE); .Internal(sink(argv[[1]], argv[[2]], argv[[3]], argv[[4]]))"); - check("TestrGenBuiltinsink_testsink1_1f2f54c86246d0e139afd22163c76df3"); - } - @Test public void TestrGenBuiltinsink_testsink3_0d11da5ed60ecce0a15b0a8857faf2eb() { assertEval("argv <- list(-1L, FALSE, FALSE, FALSE); .Internal(sink(argv[[1]], argv[[2]], argv[[3]], argv[[4]]))"); check("TestrGenBuiltinsink_testsink3_0d11da5ed60ecce0a15b0a8857faf2eb"); } - @Test - public void TestrGenBuiltinsinknumber_testsinknumber1_8599c5fbb4d4e97c1b0e82b6b0732efc() { - assertEval("argv <- list(FALSE); .Internal(sink.number(argv[[1]]))"); - check("TestrGenBuiltinsinknumber_testsinknumber1_8599c5fbb4d4e97c1b0e82b6b0732efc"); - } - @Test public void TestrGenBuiltinsolve_testsolve1_bb5b765a844f4949ff6bf0c46e4b4651() { assertEval("argv <- structure(list(a = structure(c(1, 0.5, 0, 0, 0, 0.5, 1, 0.5, 0, 0, 0, 0.5, 1, 0.5, 0, 0, 0, 0.5, 1, 0.5, 0, 0, 0, 0.5, 1), .Dim = c(5L, 5L))), .Names = 'a');do.call('solve', argv)"); @@ -11421,12 +11145,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinsplit_testsplit14_d5f5ee939bde53323df5d127bf51a728"); } - @Test - public void TestrGenBuiltinsplit_testsplit15_894df85ef61c740797eff5749f2f7e96() { - assertEval("argv <- list(character(0), structure(integer(0), .Label = character(0), class = 'factor')); .Internal(split(argv[[1]], argv[[2]]))"); - check("TestrGenBuiltinsplit_testsplit15_894df85ef61c740797eff5749f2f7e96"); - } - @Test public void TestrGenBuiltinsplit_testsplit16_9303f5e309a42a081e329ed5895ee7a1() { assertEval("argv <- list(structure(c(47.432, 12.482), .Names = c('(Intercept)', 'group2')), structure(1:2, .Label = c('0', '1'), class = 'factor')); .Internal(split(argv[[1]], argv[[2]]))"); @@ -11463,84 +11181,18 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinsplit_testsplit5_9a320b61d6ec695f1a620a875b64d959"); } - @Test - public void TestrGenBuiltinsplit_testsplit7_c8635a0f41744cd3be693fd1f670d24b() { - assertEval("argv <- list(structure(c('Sex/(Age + Eth * Lrn)', 'Sex + Sex:Age + Sex:Eth + Sex:Lrn + Sex:Eth:Lrn + Sex:Age:Lrn', 'Sex + Sex:Age + Sex:Eth + Sex:Lrn + Sex:Eth:Lrn + Sex:Age:Lrn + Sex:Age:Eth + Sex:Age:Eth:Lrn', '1.597991', '1.686899', '1.928360', '132', '128', '118', '-1063.025', '-1055.398', '-1039.324', '', '1 vs 2', '2 vs 3', '', ' 4', '10', '', ' 7.627279', '16.073723', '', '0.10622602', '0.09754136'), .Dim = c(3L, 8L)), structure(c(1L, 1L, 1L, 2L, 2L, 2L, 3L, 3L, 3L, 4L, 4L, 4L, 5L, 5L, 5L, 6L, 6L, 6L, 7L, 7L, 7L, 8L, 8L, 8L), .Label = c('1', '2', '3', '4', '5', '6', '7', '8'), class = 'factor')); .Internal(split(argv[[1]], argv[[2]]))"); - check("TestrGenBuiltinsplit_testsplit7_c8635a0f41744cd3be693fd1f670d24b"); - } - - @Test - public void TestrGenBuiltinsplit_testsplit9_1b57cbe8f915a71b63e9b370cb6ce3da() { - assertEval("argv <- list(structure(c(NA, NA), .Dim = 1:2), structure(1:2, .Label = c('1', '2'), class = 'factor')); .Internal(split(argv[[1]], argv[[2]]))"); - check("TestrGenBuiltinsplit_testsplit9_1b57cbe8f915a71b63e9b370cb6ce3da"); - } - - @Test - public void TestrGenBuiltinsprintf_testsprintf1_616a46b4d84336c3102cffdafbe6120b() { - assertEval("argv <- list('%s is not TRUE', 'identical(fxy, c(1, 2, 3))'); .Internal(sprintf(argv[[1]], argv[[2]]))"); - check("TestrGenBuiltinsprintf_testsprintf1_616a46b4d84336c3102cffdafbe6120b"); - } - @Test public void TestrGenBuiltinsprintf_testsprintf10_6172749ae549a836aadb4dd013b21de5() { assertEval("argv <- list('%.0f%% said yes (out of a sample of size %.0f)', 66.666, 3); .Internal(sprintf(argv[[1]], argv[[2]], argv[[3]]))"); check("TestrGenBuiltinsprintf_testsprintf10_6172749ae549a836aadb4dd013b21de5"); } - @Test - public void TestrGenBuiltinsprintf_testsprintf11_d23addb4a3134230d0dc4278eb1922e5() { - assertEval("argv <- list('%1$d %1$x %1$X', 0:15); .Internal(sprintf(argv[[1]], argv[[2]]))"); - check("TestrGenBuiltinsprintf_testsprintf11_d23addb4a3134230d0dc4278eb1922e5"); - } - - @Test - public void TestrGenBuiltinsprintf_testsprintf12_f4d7713d7b5a3f4a6b1a93394506cd3c() { - assertEval("argv <- list('%03o', 1:255); .Internal(sprintf(argv[[1]], argv[[2]]))"); - check("TestrGenBuiltinsprintf_testsprintf12_f4d7713d7b5a3f4a6b1a93394506cd3c"); - } - - @Test - public void TestrGenBuiltinsprintf_testsprintf13_478f180082d0ac4a879d1a33ff328f6b() { - assertEval("argv <- list('%d y value <= 0 omitted from logarithmic plot', 1L); .Internal(sprintf(argv[[1]], argv[[2]]))"); - check("TestrGenBuiltinsprintf_testsprintf13_478f180082d0ac4a879d1a33ff328f6b"); - } - - @Test - public void TestrGenBuiltinsprintf_testsprintf14_79114a50f7b2d99eaf7f123f770951a5() { - assertEval("argv <- list('%o', 1:255); .Internal(sprintf(argv[[1]], argv[[2]]))"); - check("TestrGenBuiltinsprintf_testsprintf14_79114a50f7b2d99eaf7f123f770951a5"); - } - - @Test - public void TestrGenBuiltinsprintf_testsprintf15_abe68cd9419b74554ccc9eefb2a5e000() { - assertEval("argv <- list('%s-class.Rd', structure('foo', .Names = 'foo')); .Internal(sprintf(argv[[1]], argv[[2]]))"); - check("TestrGenBuiltinsprintf_testsprintf15_abe68cd9419b74554ccc9eefb2a5e000"); - } - - @Test - public void TestrGenBuiltinsprintf_testsprintf16_f2c00ebf15d0dde06e0056b870d0fbe6() { - assertEval("argv <- list('checkRd: (%d) %s', -3, 'evalSource.Rd:157: Unnecessary braces at ‘{\\'sourceEnvironment\\'}’'); .Internal(sprintf(argv[[1]], argv[[2]], argv[[3]]))"); - check("TestrGenBuiltinsprintf_testsprintf16_f2c00ebf15d0dde06e0056b870d0fbe6"); - } - - @Test - public void TestrGenBuiltinsprintf_testsprintf17_100d8c9855a2bd879eea0aa999086568() { - assertEval("argv <- list('tools:::check_compiled_code(\\'%s\\')', '/home/lzhao/hg/r-instrumented/library/foreign'); .Internal(sprintf(argv[[1]], argv[[2]]))"); - check("TestrGenBuiltinsprintf_testsprintf17_100d8c9855a2bd879eea0aa999086568"); - } - @Test public void TestrGenBuiltinsprintf_testsprintf18_7c78033017935e48884a106c97df1044() { assertEval("argv <- list('%5g', structure(c(18, 18, 0, 14, 4, 12, 12, 0, 4, 8, 26, 23, 3, 18, 5, 8, 5, 3, 0, 5, 21, 0, 21, 0, 0), .Dim = c(5L, 5L), .Dimnames = list(NULL, c('', '', '', '', '')))); .Internal(sprintf(argv[[1]], argv[[2]]))"); check("TestrGenBuiltinsprintf_testsprintf18_7c78033017935e48884a106c97df1044"); } - @Test - public void TestrGenBuiltinsprintf_testsprintf19_8449b4ebb95f08588a64017df0462c09() { - assertEval("argv <- list('%G', 3.14159265358979e-06); .Internal(sprintf(argv[[1]], argv[[2]]))"); - check("TestrGenBuiltinsprintf_testsprintf19_8449b4ebb95f08588a64017df0462c09"); - } - @Test public void TestrGenBuiltinsprintf_testsprintf2_6f783f16dea8a9ca3ce36d08b5e20bd2() { assertEval("argv <- list('%1.0f', 3.14159265358979); .Internal(sprintf(argv[[1]], argv[[2]]))"); @@ -11553,24 +11205,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinsprintf_testsprintf3_4500fd7dacd66c3f6fa9f34111311bc6"); } - @Test - public void TestrGenBuiltinsprintf_testsprintf4_4ba398000579f50256b550139ded0f38() { - assertEval("argv <- list('%o', integer(0)); .Internal(sprintf(argv[[1]], argv[[2]]))"); - check("TestrGenBuiltinsprintf_testsprintf4_4ba398000579f50256b550139ded0f38"); - } - - @Test - public void TestrGenBuiltinsprintf_testsprintf5_64e1e861b692ffee9902ef9fbea83743() { - assertEval("argv <- list('%*s', 1, ''); .Internal(sprintf(argv[[1]], argv[[2]], argv[[3]]))"); - check("TestrGenBuiltinsprintf_testsprintf5_64e1e861b692ffee9902ef9fbea83743"); - } - - @Test - public void TestrGenBuiltinsprintf_testsprintf6_42afa56096704b74cdced3cc2cefb49d() { - assertEval("argv <- list('p,L,S = (%2d,%2d,%2d): ', TRUE, TRUE, FALSE); .Internal(sprintf(argv[[1]], argv[[2]], argv[[3]], argv[[4]]))"); - check("TestrGenBuiltinsprintf_testsprintf6_42afa56096704b74cdced3cc2cefb49d"); - } - @Test public void TestrGenBuiltinsprintf_testsprintf7_a11bbe5e012da496a5b842776046cc72() { assertEval("argv <- list('p,L,S = (%2d,%2d,%2d): ', TRUE, FALSE, NA); .Internal(sprintf(argv[[1]], argv[[2]], argv[[3]], argv[[4]]))"); @@ -11697,12 +11331,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinstrsplit_teststrsplit10_575c83bfde53fe0914403b6d440f0f0f"); } - @Test - public void TestrGenBuiltinstrsplit_teststrsplit11_c85911589c86839478dfc0ab22a937a6() { - assertEval("argv <- list(structure('pkgB', .Names = 'name'), '_', TRUE, FALSE, FALSE); .Internal(strsplit(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]]))"); - check("TestrGenBuiltinstrsplit_teststrsplit11_c85911589c86839478dfc0ab22a937a6"); - } - @Test public void TestrGenBuiltinstrsplit_teststrsplit12_5de2449138882559ccc5a074c2e9851f() { assertEval("argv <- list('Keywords: utilities ', '\\n[ \\t\\n]*\\n', FALSE, TRUE, TRUE); .Internal(strsplit(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]]))"); @@ -11817,12 +11445,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinstructure_teststructure1_9df14c1c2e0a59dd73ee3393acc49b1b"); } - @Test - public void TestrGenBuiltinsub_testsub10_8d6b7828b958f5447e6d29a1c78b3799() { - assertEval("argv <- list('^[[:space:]]*([[:alnum:].]+).*$', '\\\\1', structure('MASS', .Names = 'Suggests'), FALSE, FALSE, FALSE, FALSE); .Internal(sub(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]]))"); - check("TestrGenBuiltinsub_testsub10_8d6b7828b958f5447e6d29a1c78b3799"); - } - @Test public void TestrGenBuiltinsub_testsub12_18c19215e492e38ebc1c19bacd9268cb() { assertEval("argv <- list('.* : ', '', structure('Error in rnorm(2, c(1, NA)) : (converted from warning) NAs produced\\n', class = 'try-error', condition = structure(list(message = '(converted from warning) NAs produced', call = quote(rnorm(2, c(1, NA)))), .Names = c('message', 'call'), class = c('simpleError', 'error', 'condition'))), FALSE, FALSE, FALSE, FALSE); .Internal(sub(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]]))"); @@ -11847,12 +11469,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinsub_testsub15_efadebb02fe28ae700fc046ae4ceef86"); } - @Test - public void TestrGenBuiltinsub_testsub17_80f9e2840d0a867ca64b619296c7d243() { - assertEval("argv <- list('^msgstr[[:blank:]]+[\\'](.*)[\\'][[:blank:]]*$', '\\\\1', 'msgstr \\'<U+043E><U+0442><U+0440><U+0438><U+0446><U+0430><U+0442><U+0435><U+043B><U+044C><U+043D><U+044B><U+0435> <U+0432><U+0435><U+0441><U+0430> <U+043D><U+0435> <U+0440><U+0430><U+0437><U+0440><U+0435><U+0448><U+0435><U+043D><U+044B>\\'', FALSE, FALSE, FALSE, FALSE); .Internal(sub(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]]))"); - check("TestrGenBuiltinsub_testsub17_80f9e2840d0a867ca64b619296c7d243"); - } - @Test public void TestrGenBuiltinsub_testsub18_65cd5531a1824a8a9854980cb648276a() { assertEval("argv <- list('.*Content-Type:[^\\\\]*charset=([^\\\\[:space:]]*)[[:space:]]*\\\\\\\\n.*', '\\\\1', 'Project-Id-Version: lattice 0.20-10\\\\nReport-Msgid-Bugs-To: bugs@r-project.org\\\\nPOT-Creation-Date: 2012-03-10 14:42\\\\nPO-Revision-Date: 2012-08-31 16:36+0100\\\\nLast-Translator: \\305\\201ukasz Daniel <lukasz.daniel@gmail.com>\\\\nLanguage-Team: \\305\\201ukasz Daniel <lukasz.daniel@gmail.com>\\\\nLanguage: pl_PL\\\\nMIME-Version: 1.0\\\\nContent-Type: text/plain; charset=UTF-8\\\\nContent-Transfer-Encoding: 8bit\\\\nPlural-Forms: nplurals=3; plural=(n==1 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2)\\\\nX-Poedit-SourceCharset: iso-8859-1\\\\n', FALSE, FALSE, FALSE, FALSE); .Internal(sub(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]]))"); @@ -12633,30 +12249,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinunique_testunique4_10eb84e0d2dcb2035b9f0336a68e2238"); } - @Test - public void TestrGenBuiltinunique_testunique7_082eba594b16036fba4b798f0c39c014() { - assertEval("argv <- list(structure(list(a = 1), .Names = 'a'), FALSE, FALSE, NA); .Internal(unique(argv[[1]], argv[[2]], argv[[3]], argv[[4]]))"); - check("TestrGenBuiltinunique_testunique7_082eba594b16036fba4b798f0c39c014"); - } - - @Test - public void TestrGenBuiltinunique_testunique9_687732fcbebb2f8bd30a841a31f4d5a4() { - assertEval("argv <- list(list(FALSE), FALSE, FALSE, NA); .Internal(unique(argv[[1]], argv[[2]], argv[[3]], argv[[4]]))"); - check("TestrGenBuiltinunique_testunique9_687732fcbebb2f8bd30a841a31f4d5a4"); - } - - @Test - public void TestrGenBuiltinunitsassign__testunitsassign_1_2c87fe903851db3f18f0b22fb1584518() { - assertEval("argv <- structure(list(x = structure(500, units = 'secs', class = 'difftime', .Names = 'a'), value = 'mins'), .Names = c('x', 'value'));do.call('units<-', argv)"); - check("TestrGenBuiltinunitsassign__testunitsassign_1_2c87fe903851db3f18f0b22fb1584518"); - } - - @Test - public void TestrGenBuiltinunitsassign_difftime_testunitsassign_difftime1_89ecf98c73b6274d721260d35b2439ea() { - assertEval("argv <- structure(list(x = structure(500, units = 'secs', class = 'difftime', .Names = 'a'), value = 'mins'), .Names = c('x', 'value'));do.call('units<-.difftime', argv)"); - check("TestrGenBuiltinunitsassign_difftime_testunitsassign_difftime1_89ecf98c73b6274d721260d35b2439ea"); - } - @Test public void TestrGenBuiltinunlink_testunlink1_5ead42fd735cfdc73231e3241d3171cb() { assertEval("argv <- list('/tmp/RtmptPgrXI/Pkgs', TRUE, FALSE); .Internal(unlink(argv[[1]], argv[[2]], argv[[3]]))"); @@ -12999,12 +12591,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinvector_testvector11_7ee9a8983c7e8f214e428a5c8176649d"); } - @Test - public void TestrGenBuiltinvector_testvector9_3ec6b6e35abf3a65efefe2397e0034e4() { - assertEval("argv <- list('raw', 0L); .Internal(vector(argv[[1]], argv[[2]]))"); - check("TestrGenBuiltinvector_testvector9_3ec6b6e35abf3a65efefe2397e0034e4"); - } - @Test public void TestrGenBuiltinwarning_testwarning1_34fbe2e558b975829460c2ad85dee3a1() { assertEval("argv <- list('OGXAGDISZSNLYDBXLBQMQHECNODETNWRASXQCXRDTYKHGFOTROVTAJBUYOWPRNTXVBABWOIYPNJIVBJWSRJODUXFUPYENWWAZMKKCEKIKHOEYBJZQBKLNLQDXOODTMUBVHHQYAJKLSXQXTDDELCFOKOVQKSCHPEWWMUHBLMIENAUOQMHLUPKVIPLGOGOLDQODOLLVSLNGBKAWZSVXOOHRGHSSEHJCSODZOUWWUQQHAKJKEIKTHDAUMUCCDTTZQHFUSFTWNPYYRBVMKHGKYGOFFSIDBYODOOVSOSTJHNGVKBYFKQQIDXPTXNJBWNFJFLGDBRHDZKKQXFOSKCQAFRWUDKUSPDOLTAFWCZKWXMSMZBEUOKZGNCVJUFYINCXYBMFWNAHIPGBCSYICIQLUHOBESVNOADWCGZPGPADSBQYCZASLOWOTQIKFWPTOHTOINVNFWJHUTVOAMOVSOBDRCFJWGSCUGOAUIXJZJMMAQNIPQLESTVNHLJGRYHQNPAADACMFVGMQEVLGHEPDEIEKPRVJYAPMJWBWEFWBGZRLJLURMBGGFBMGTOYCYSXPEESPIUIWPKYMCMZYLWHUUKJQWRNDPBMTTBLNHPTSDOUGSVDYTVEAWXDMMSBTKLSMZVVTCVVZBTKPVAAZTIVZFQLYZLFSOPLLPLYVFKKAJKESATLTABKQFVSXKKGJGYMBUIORHBLPZZCMKKIRHKZUIVFNEDXCWHAUJATALGMQCECVQQKLJUXQPIBPETHQDGVUBWDPMOSMZZKPILFAABTMWPEPXUNKRXXEGCUCVUYMYUWKCHSJJANDXBUWAHQUKYKLHPOBTFRNQQHFOZIIANPTYMCGWWVYQMESCLYVSDPZQHBBWJYONYCVJOICUFRLFZLAYWPHVYWDZOADAVUYJZVUQZMXKLYRAEMLZXISXRQDPHLFGQMEHSPDBZJRVGAPVJIQYPNEVFRQBYPWNGPURMMQLPAZKDWOWAWSUWNYFAIRIYUIMKUMAQGTHXWMBPPZIRYORCWNFKXMRHVGJGYKDXJWDJGBUFKIPOZGTZOKVCNLHEWOOPSQPBOPQQCCRVDUMZMOJNBOYNLAABEMUHTNHARBVDRVGDTFGNMJUOEZGDFJJHBYOFWMOUQDIYETLDFRDKLQGMEWECXHTKLEDDNMQLBAFWGPPZETGIAZLZFCGRPKSOPPFCTPYYTLELTXXVFBMPCYEXDRUTRDWQVEAIHVYDXPKRTNKZBDSSCMQKZRIDHCAITYKNBQJLZRSEFWVSHFMNFTASVYRHFWAWNLYEJDDROMVZNSEJBDCHKQSIZSEJHLVGKZDQSPZBZTLDLELVBIVBUZRAMSAVTGTRERYWURPKDVSUAEPCSOHKRECNCCQOHGQVBZAEIWEUWMQIMYGAZGRBZXWLUHHZZMTIGQIBZRWMDRAEXDGGIFAXYYLLBJXJNNEOCPOFXFKWGHWQWMXEQSEORXIOAJQPVDRFPSNJSMGLCGOAFQSUBCYYXQEXXEBOJLMUVHSMBAGFKOSGXMGIRSOWKFMJGYMAYJAZJZDOUFSOAGMYZFOQXTPFXUIFRTMWREAWCILQIPVIJPMCVLTUKATBNDRBURGEBAVGBJPUIDUWZRGQLFPZFLIACKBAEJPIMTEVIGIUGXDFQGSTGOXSVXHQDWRTIRMQUXNEHDGSQLQNIUQUEKZJCNYWORNYCMUWXVDSTRXKYLFPENKVOLFMGIWLLMVAICVMNKLCAACJTTCZDMOYVNJOUQCEVMUVHFQJXDEQERNTICKOTEPMYXDHSTNFEIBRTGMBCXPQLHYAEZUZGPBUWXAGPJSBRFHTEKRKOLDAEUDBAKWILKJYYHSFYBZFIDPRZFVQZLSBQFXVWVKZMMIBXFHROZCOXWXUEDDLUXLVMRTRWIECAXUCCENTDCOHLDXTLRHRJRKSHTOAJLKOWTBDIITDZWPXAUXCMRMWKOQHXDOGBTPIXPYXKSVXDBZKSNKSWDJUFQJPOSVLJVNTWLKWSPSTGHFYHMAUKLYKTUFBIRTQYAJQCADTWIGGYMSXPGXSBQWDYBEAKSRMCZOSHUQXKITSLUHXQUSRSFPTGRCTYRRKDMCTJOJFNKWCBEYLRAMBQWFHWAULCXETLREWBFGTKHCNLZDVAUFDEFYZIDRPIVHVDWBLRFYJQERTMWVZRQBEAWLVDKSBIUVWYJYSKKFTLLCJXOAKCHSJQMUPEYBCVKSTZYDRAMUJYRLVULIOWPQTSWCPGMHXKOCYTMESPBBLEMZFSDNVDVGCERRDZDYSOGIVXNXSLHZDRVFPEKGNRXIGIFDGYBNUVOGPDMCHRFKUFBURNFEPBFVHAZCTVAWOIIQDIPTORJXZTANUFKOTIILHQBPKBZQVKYJVAWBVPRSHRHOBJMNVNWPNQHOZXUVXPJTMARKYDJXUNAGHRCZWHLIJHXHWVEFRMCDIPYKYCWGHEACDFVAKXAILOXNTQFNBUFWNGVBAPWLNFSNBVGNICWQWDRPYPHYVLMTGVVKXBVMHQIQXOQKUWJMXMFRTQFYAXCVOPVGBDCEYFIRSHHLJXNPNNLFIGAFZLZGDOLWXQVHXDDPZNDEUQOTIKJQEGYZNBPSPNJCDJPGAICGDJDOOEYQBERXVLEEMKUUKQKJQYMQHKLHZWVSEBCWJUXQPBGKVJLODARVYBRKODGISEDOBLMMMTZVCWORUKWEMDFXMOZZRUASXLSVMVMALMPLHRPZEZPTWQSZWTDCNFTMDVYHDSOCOPOKKXRYDOCQGMMVXOYHQQQGKENPCSPRHJQYJFGMKIJRWMPMRRCCYKOYFFQVVDCUYQLRWNNUJYAIDIMTUKAYXPXQDDRXDXLBVZUHFFJFECQUBCADYEZSIIUMMGYRSHPYANWHJXCNKELEWRDDHYYEXBWBYEPSHASIWMZCAOPATBMYBYUWFZSHVYXDBVWBFSCAXBWDKFUOFLLXMYKUTIYNILMVYMJFASSAENEGXJZSDPWTMNOFXEPMFZIBTOAHWGBSNKLXXFOBOCTCFTKOWSTPCVTWCVHIXEASAVXEFUXGLKRHUIGAJPIEZGODRLJKKVXTJRNAQQIAZZBNZCJMXOAWVWVACVFAOTWBFKKPYZDHVZRCDIGGUEPRXRHABEWBHXOUYRKZYNDQVDPZFKCHNIPZPDSRILHVPUHDXAOZGZAGGYZTHKFTTMRTUPKRWLDQMYGUTROPWMZBOEHVFPKHMTZEDPDFIGSSUHEMOQMDWZWWJQNATVBXJSSRHHMBMPGZEOKDJZUJYSMVRJMPSJPNPXWVEIYYQUOBHMLYQAAHHVSRJEFSGFPDBAVUAPHPFYCDDHPFLLJZAWCELSEDFEWTOWDJIAKSGQEUMBUWPPKBQNUOLVRBDVKNIQPFQJLKFGELPKXHFOJYQLHAOIMVFCUEUAWVXJHXIYPPTKJLISGWYMAYLVNMDBQJABVTBSAPFQONGJHEQADNMNRZYYRTYFRCMTAECUJQTGJISODHKNPIJYOPGKQJMEMYAJGPBQBHILLZPIWIRXVCHNJVWRNUBGFVVVHAQTNJIJJOQKPSXYKQECOVTOZZIEJOVSXSGITFHXEDTOOSQTHZZATJJATECSLAXULDVSKEAIEOPHYSHSPKEAEPFBXWVPSUWSIMUKPHDHFFNXPGJOERAARFJESPBKCKLQCIAIUTVBDQKEDDQNMWETFEDXRLSSQXFLAESTLJMAWQEOWFIUGBKFQQKDELKBAWHZRWLYTHRXTRTCBJNYYQINRWOCSVKFGANPPXLGNBRTFEWHZSYTIJAXNIVUUNCXDVOOTKVWUKESCBAQSEUUQYDBYWJKZCSOWTQEMLEVHQMOPCMELROGHAHSBZUXNIMCFJKRDMDOAUVFOPDSWYTAUIKAIILVRJUJYUHGEXOXZOIRWZKTILGSKRYBQTRWUWZOUPBMDOBTACXZIQQPWUHBLLQTPMFLTGSUKICMTNYAXPVLIKHDHHIATLPCAEAYMUOCALFUNOYBAOCGDDOBQTJSBPGEHPKQYNGTNDGDCQTLDVZANUNGMHZSTAKLDGDKFNXNLHFBUYXHGIIPQCMBRYYXMJKYRKMTTMKKRRBLNEHFDWIBQTNNTXVNUFJKCAKEWPLNBTRDPQIROHXBXVIKNOBIGCZIYVKUGUCFZBORHMWMDITBYRKDYGTAGZSQGCHOUHIYMZVZCIYQZZSKRGIVRUIQPFGWUATXXDZXGXVLBWIGVZFCQWENJVMGHVAKPNRNOVIAVUWBAPWLAKJMDMGMXNSBRUAAPUTGULEPVUCBYCFLUWQKDWWINMUXPVUHNHWSJZSGQIUIGBOAHHVDGLYIUDMNXJMLSBSRRMHJCGBMIFTGKSCDZZTAZTXFHPITBXUWYIEDCMVWBTZISPBLQUOWALMUHPEUPHUPYEAJUOECWDQLYPBNRMQMWGKUWOIPIENADEIJWJYMWIIEQEOFCIPRFKDFTMGULEEZNNRUSWDGXJYIQNOMNJPGQROITWJLWKMNBKLORRXRNIADNNCGEHDLFCWFFIITOEVXGTFVHTDVVWAAHIBSAVNTYOYIHZGUHSTHAKPLINFHANKZBQMAEQNXRNHKDJHYGTBJFWLIKEQUXPQRYZGHXJSVDVRACLVIHXKOGDFNYKVCTGNBUXTCYEURKTKPIQJWKLXQARGZLRCFYOKPDMEGVRZDLMOLESXHTYANGMKVDWKQDWQNQZUYRLYRJJALNBTDIJXQWKSFNXHHLXRLVGJDGRZVSNEZVZNTUNNSMHNPRYHGGLLKOJJHQEDCBRZURRIQKDUWKQOXKKICSXODXKDXLLKIDUVFLGCTHNDMWAZUGTMAPKZLAAHDCLKHKOGBZEPYZPUCCDFIPFHCQWTPRTLFGLCAQNVRMWUJZFZLIWSOGNTMMNPMFNXBMWIPMTNZYODGZKFJOAAIGATUSBRTIKAMDUKYTLUJJRLSLRNXYYGLKENYCREGPCRQWFIKYBFSBZANWHQOLYJIYCXHECCGWKSYHTRHAJGNRHMJCEVMWVESLPTYUYHAETQNABEZUNBHCSKXJLBLSVDOLSKLTGMFLXYPQYTYRGSMXYMLPSZMHVXPHLYNGKFNWAVGSRPQPRZVBNELCCVYKJLLZTHMZOCBXVQFJDLUXVYJBHZLZSHXMVGYMDUDORONYFAHIXODFCWBINIWWXUXLKJNBSGVZCMRVTLYSIMZXFHJBZVRKGYJONYNQGJXTUICYLOEAFIPBGAFNITYFZCTHHBFTISFBSGIWALDNZRWTNXMUNCOJNQGLCACFDVKOPBUPULQTSZHBLHLLQAGMXHHZMABYMVVTPONGQWTEJTCRSWFHVHWQGQBXXRYOUUGHFWSDWQOBHPYBLKNBWGLFYSKHSFHXMYUWOBNXACQMZTUKZLZOTRVRABYLQPYSFJRGPCYGHLMGFSKQQBMQISXKKMBIEJLEBRKCMHCENENJVINGIKQBSOITGCJCFZDPRNKKNRZNMHEIHJMJLFBWONQFNSAQTLURPETKCEUDMJMOYEKLWAAIIWODBDVKZSGXQZCUZTUZIJEKKPKCRAEZNHAIWEJOMSVKFNHVGMCHVMLFGOSEEXDAHRNIEZTKCRPQTPCSAZYVGPIZWSUTIXBOITQKWOWNQGHZZHPJZXNMKWXHWMQKCEAJSGKUUKTMFFBPZBSAZZSULTRANTASWMGULWQLNZRVKXAJRLFERRKPKNWGRKOZPEWIWCBCWKWJJGMFVKTWWJOCDDEAGBBFEEPDSZSYXZGUSLRDADRIJXMTQVNLMBPQEKHJUZNVZKXARKHVOQJPXWZLWJBKMTGKKUNCMCXOYUQIUHGAKQVEZRVYPIUTWLVQJDORBXEZCDLSJHSSTLFKHTOUNPRRDQGPSNTVLTYUYWGSULVDNIOEZJVHNKSDJGVQTPZIJVJBARWYMIDQFHMMIUGECHFSNREUFXCUCDFORINMIVXPHORLQRWDWIVYFTOEHCBEQSQRCHYJEVVJRMDQVLLGCIFDORIXGPRULGOLOLYBINRRATGXMBJTMTHKTSFCNPCAEQSYMYKAASYJJMYACQFHWQJLMDOQKSYNLSGIDXZJNHEWKWQTAPBYLEOWBYWNVSZSNWEFBVSBXZVHLJBPICAKINJJAZOANLNWBFBLDZDAMFLCHTHFCRGGDLRUYORAXHITCZVDDKCMUGKCEZRYPCVAVKDRQLUWZKJDZYYKUKAKYNRANTLTOTSISOWBJQAFQXMETAQODBBEGUEZMKNVBCYYKMKFTRNFTNEOJWWHHJMOMVEZQYNVZAEVQUTGGHBCOMHNNBLBKODDHJFVIIRODTKDVXYVLXIISBNSSTYZJYPICEDTHZJDDFXYEZGPDBLHKWSZAMJGHQWOEEESYXLNUTLPYRKKCWZPXHRTKVPMEAYYNFWJMYOAXDHFECOWAXWRRIDIOHLHLRAVCIRQVAXNIEQWRWCAFVIHDLWVOTUFHQFIEXUBQUMXLAUTLJHOHKITBVXSDLHIELTKQPRFVSFEOBJPERMWHTYPZTZEUDGCTNUTWVUYNQELWGVPEMUJGGIEJEYYLPLIRBCOCIBMPKSUNMTLSZPWXOPGOWLEFMIUBIKJRREOKKPKBPHRJXWIYXABSGECTQJRSCCNYEORABQUZMYDYMEKVJZBRHHLUBWQGXUUGFXGRIRSPMBEVBZSKDNRMNKTGWXCSWRTUJJMBRYTEBNYXCKAZVABMKVCSAOIVTRQOGAMVLSMLIAQPDJQQJJJXTDIGEZCBTDAWIMOCCWNMTEAPEFYEGPEQFNIOOHGXPMTBQQUKFQLOTDNDPFNWORMYDKOQIVYXHOOVAOGRFEXMLPOQQDHTQQYPTETUFKOMPHGUOEZMEFSCDKQADGSLCJNNXEKKLAXTZXZJJUDNTFRLXHOAOOYROETHRDMCHDJMALXFBIHMJRXKNIVEJRYFRCSYVEBOMVPRFINYGHPBATPTGUVEAINZKKVVBLHITASDQBPDBSUTPMAGLRVETLGKVYIVQFVTQFGKUSYAEQLHVGFABOIEWYCPKEVRNNSWYXVDSQREDOUVSXRDNHCAOTXTHTAPZQHIWFTJYZMPJJYQZIQXOUUAGHRBENJMUUFDUCRKYBZUHIQCYJPTGXEXXQZRDSOZBDNRJJMXZYCARBZHHMFFNJXGJZDFNKALBXWHRCAWTXABIKQLBMXIXEGWWJPMTFTVCHAPZVPIQADNWCZYYTALDLOTTXHOFUPOEXZZADSCAAIPYGWWCABPNREBRAEPBBIDCHWSJCMEXBZJMFQYXOLZDJVUBLKHIYHXAHHCXOIYGWGAEAOOSWYLBHQYLZPODKNPDJTEEBNIATQZWMUTWTCRLNMNTRLKKDYGWWBIJKEYZSIGWXNPOQRULMUMSQBJHIHVHTWNYVEBSBDLHKQVLIGBCPJENVSBEASLDGHZREGLFQMUNIVYKEBUGRGDEMQYZGUGLWSIYLJUTOSILYNITUMTJIHZPKMBJLOQFVFTXHEZQYEHKBQFESSGPUJEPCNTFOCJOLEJMABCETPTWZOBEJIMWSSDUPVFQNWBEEQFJRPWXESEGMJJENMHIIUHILTNTTIPYRNEGMNOECTFEIXNAADXJQGSXRMPQATNOMVARUTBBJDBAHKWYMEJQXRXPJKFGRGRNWXDFMLROFUCKATMBMTINMDBAUJOTHQIJUNJOZFVNFODGTPMQTSETNRMQVMPRJCJTOHGZPHCAIXVHMSXPNWVEQDHWUEVBEUPMYZOQTJXGPYBCLTUSEHJYIFAMUQEZCTGYHGPBBVDBHCNSWMHUQYWVAQKSUOLYUNLUUEONJANOIBXLXKRVJGHGEAGTKWQKZYUIGEWPCTEBDBMNARXATBWQMVWJQXVHGLGXRMDNZEPNTGQAYEIKLOOWLNNLIWVZLMMWNREMRAJEPHNDQDRIQVUEGOIKRUENWLKHMVEWWNQZQMIZGLGBYCMEZYNYSRFQWHJGSGCETHRGASFUDYVASRFJKKUBBMNFPQRDDZGFRKOCUJVZOJZSOEQYRRDGOPJJPSMFIRDYEXAQPQLRTVPQGSHTCPFTZNTVCIAOHNRDPXGDGXPDSEZUKMKARYGAVGCBOHANSJKHYLDPCFXAOEBATTFZRDWEMESUYNHREUTPORPDRMPGSCCDRVZCMIIVSQXTMQSLIAGHICXJYZDOOGRVCRPMIKALTMHTBOZGUUWGOXAEGUBXIXPLSTNABRSLFSAOCXULPTFLATSCSSLJFQCEHSJZEYDVWGHQQLPARKIJSMOHXTOZGWYTKNONYWQXTHAVCDEDPYTNCNUVZKWFEODBGIYLLBJOWGYWFKQDHPEMWNJPSJEJPTAYDAVLGVMDDWBJKTSYEVOXYAKCMSMEPHTXGOTNFKOBTADKPQQCKAIXGSXRCVSSLDCXFCEIRQKPXSMVHFHCEDMSFIMRRWAGIVQGMTCNRFMVWTQFFNTZJFSLXXJDTZBGAHAMOWAZARZTQCPOMAXKKYUKOMHNELAOMBBIIJDSOPXFVUFXACKODFHHQRMUZQNHWWEWKEUQTDCYGPMWLQHLCUYDUBWGNPWIRILVGICVQFVKKFEIUDDRKWMPVYBBSFESJTNQMYLYEBQIQBIDSPYQQFUQRGUPROKKQETIFRPIWJGDMILMXGFJODKUGZZIQRWYSJVJZTNEVLXHXEZRPLNZPAWTVFQKRDVSBXXREEPYYLPOGMIKMNEDMWMTKNQVMCIWIPHSHIHFGHEWPWNYXMEFTYGBQLASFDXBVRNYMGHGMEGYHGYFUFZHVHLSQQPRXGJTZAGWLPLIKRZCGGSOBBDMUMDKNCEWJBDBMHOYJOAPIKAPFTRTHXDFULBREUQJATSHPJUVVACPLVAJWTYGXOMNLMKCVLGFFJRWFHLMTOZLEUEMHOZESJRGFRCWSIZAHFHEWWZOAYNRNBTRSFJNYLBLLJKZAYZEWPWWNWSEFXCGXOTOOAOLKAUAOQKQSVIQPGTFPUBYMUMPIMQYTAWVJLJDEUVEPQFOUOFAROYILGVDHDVFPXFTKPWYFYKVFDQYRKNKJ');do.call('warning', argv)"); @@ -13101,12 +12687,6 @@ public class FailingTests extends TestBase { check("TestrGenBuiltinwithin_testwithin1_848180660a72bcab410265b73db45ed4"); } - @Test - public void TestrGenBuiltinwriteLines_testwriteLines1_d6f43d236f0f017f994619383dfd8fbc() { - assertEval("argv <- structure(list(text = ' \\' A \\'; \\'B\\' ;\\'C\\';\\' D \\';\\'E \\'; F ;G ', con = 'foo'), .Names = c('text', 'con'));do.call('writeLines', argv)"); - check("TestrGenBuiltinwriteLines_testwriteLines1_d6f43d236f0f017f994619383dfd8fbc"); - } - @Test public void TestrGenBuiltinxtfrm_testxtfrm1_3b92963ab424a885d5c6f528462f1f42() { assertEval("argv <- list(structure(c(4L, 5L, 3L, 2L, 1L), .Label = c('McNeil', 'Ripley', 'Tierney', 'Tukey', 'Venables'), class = 'factor'));xtfrm(argv[[1]]);"); diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/library/base/TestConnections.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/library/base/TestConnections.java index 443c673408..729947e536 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/library/base/TestConnections.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/library/base/TestConnections.java @@ -114,5 +114,4 @@ public class TestConnections extends TestBase { assertEval("{ con<-textConnection(c(\"a\",\"b\",\"c\",\"d\")); pushBack(c(\"G\\nH\"), con, newLine=FALSE); readLines(con, 1) }"); assertEval("{ con<-textConnection(c(\"a\",\"b\",\"c\",\"d\")); pushBack(c(\"G\\nH\"), con, newLine=FALSE); readLines(con, 2) }"); } - } diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/library/base/TestSimpleDataFrames.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/library/base/TestSimpleDataFrames.java index 900a97df96..2fc6ba2cb5 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/library/base/TestSimpleDataFrames.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/library/base/TestSimpleDataFrames.java @@ -105,12 +105,6 @@ public class TestSimpleDataFrames extends TestBase { assertEval("{ x<-c(7L,42L); y<-as.data.frame(x, row.names=c(\"r1\", \"r2\", \"r3\"), nm=\"x\"); attributes(y); }"); assertEval("{ x<-matrix(c(1,2,3,4), nrow=2); y<-as.data.frame(x, row.names=NULL, optional=FALSE); attributes(y); }"); assertEval("{ x<-matrix(c(1,2,3,4), nrow=2); y<-as.data.frame(x, row.names=\"r1\", optional=FALSE); attributes(y); }"); - } - - @Test - @Ignore - public void testAsDataFrameIgnore() { - // TODO enable when error messages are corrected assertEvalError("{ x<-1; class(x)<-\"foo\"; y<-as.data.frame(x) }"); } diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/library/base/TestSimpleVectors.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/library/base/TestSimpleVectors.java index b374827bbc..73ad9cfb06 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/library/base/TestSimpleVectors.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/library/base/TestSimpleVectors.java @@ -64,8 +64,6 @@ public class TestSimpleVectors extends TestBase { } @Test - @Ignore - // S3 recursion (sometimes) public void testObjectDirectAccess() { assertEval("{ x<-factor(c(\"a\", \"b\", \"a\")); `[.factor`(x, 1) }"); assertEval("{ x<-factor(c(\"a\", \"b\", \"a\")); `[.factor`(x, 1, drop=TRUE) }"); diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinReduce.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinReduce.java index 89caedb221..a3c08cac2b 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinReduce.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinReduce.java @@ -2,9 +2,9 @@ * This material is distributed under the GNU General Public License * Version 2. You may review the terms of this license at * http://www.gnu.org/licenses/gpl-2.0.html - * + * * Copyright (c) 2014, Purdue University - * Copyright (c) 2014, Oracle and/or its affiliates + * Copyright (c) 2014, 2015, Oracle and/or its affiliates * All rights reserved. */ package com.oracle.truffle.r.test.testrgen; @@ -15,22 +15,17 @@ import com.oracle.truffle.r.test.*; // Checkstyle: stop line length check - public class TestrGenBuiltinReduce extends TestBase { - - @Test - @Ignore - public void testReduce1() { - assertEval("argv <- structure(list(f = \'+\', x = 1:7, accumulate = TRUE), .Names = c(\'f\', \'x\', \'accumulate\'));"+ - "do.call(\'Reduce\', argv)"); - } +public class TestrGenBuiltinReduce extends TestBase { + @Test + public void testReduce1() { + assertEval("argv <- structure(list(f = \'+\', x = 1:7, accumulate = TRUE), .Names = c(\'f\', \'x\', \'accumulate\'));" + "do.call(\'Reduce\', argv)"); + } - @Test + @Test @Ignore - public void testReduce2() { - assertEval("argv <- structure(list(f = function(f, ...) f(...), x = list(.Primitive(\'log\'), .Primitive(\'exp\'), .Primitive(\'acos\'), .Primitive(\'cos\')), init = 0, right = TRUE), .Names = c(\'f\', \'x\', \'init\', \'right\'));"+ - "do.call(\'Reduce\', argv)"); - } - + public void testReduce2() { + assertEval("argv <- structure(list(f = function(f, ...) f(...), x = list(.Primitive(\'log\'), .Primitive(\'exp\'), .Primitive(\'acos\'), .Primitive(\'cos\')), init = 0, right = TRUE), .Names = c(\'f\', \'x\', \'init\', \'right\'));" + + "do.call(\'Reduce\', argv)"); + } } - diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinallequalPOSIXt.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinallequalPOSIXt.java index b16dff5963..65e5f9dcd6 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinallequalPOSIXt.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinallequalPOSIXt.java @@ -2,9 +2,9 @@ * This material is distributed under the GNU General Public License * Version 2. You may review the terms of this license at * http://www.gnu.org/licenses/gpl-2.0.html - * + * * Copyright (c) 2014, Purdue University - * Copyright (c) 2014, Oracle and/or its affiliates + * Copyright (c) 2014, 2015, Oracle and/or its affiliates * All rights reserved. */ package com.oracle.truffle.r.test.testrgen; @@ -15,22 +15,18 @@ import com.oracle.truffle.r.test.*; // Checkstyle: stop line length check - public class TestrGenBuiltinallequalPOSIXt extends TestBase { - - @Test - @Ignore - public void testallequalPOSIXt1() { - assertEval("argv <- structure(list(target = structure(1412833061.16639, class = c(\'POSIXct\', \'POSIXt\')), current = structure(1412833061.16839, class = c(\'POSIXct\', \'POSIXt\'))), .Names = c(\'target\', \'current\'));"+ - "do.call(\'all.equal.POSIXt\', argv)"); - } +public class TestrGenBuiltinallequalPOSIXt extends TestBase { + @Test + public void testallequalPOSIXt1() { + assertEval("argv <- structure(list(target = structure(1412833061.16639, class = c(\'POSIXct\', \'POSIXt\')), current = structure(1412833061.16839, class = c(\'POSIXct\', \'POSIXt\'))), .Names = c(\'target\', \'current\'));" + + "do.call(\'all.equal.POSIXt\', argv)"); + } - @Test + @Test @Ignore - public void testallequalPOSIXt2() { - assertEval("argv <- structure(list(target = structure(1412833061.16639, class = c(\'POSIXct\', \'POSIXt\')), current = structure(list(sec = 41.1663863658905, min = 37L, hour = 1L, mday = 9L, mon = 9L, year = 114L, wday = 4L, yday = 281L, isdst = 1L, zone = \'EDT\', gmtoff = -14400L), .Names = c(\'sec\', \'min\', \'hour\', \'mday\', \'mon\', \'year\', \'wday\', \'yday\', \'isdst\', \'zone\', \'gmtoff\'), class = c(\'POSIXlt\', \'POSIXt\'), tzone = c(\'\', \'EST\', \'EDT\'))), .Names = c(\'target\', \'current\'));"+ - "do.call(\'all.equal.POSIXt\', argv)"); - } - + public void testallequalPOSIXt2() { + assertEval("argv <- structure(list(target = structure(1412833061.16639, class = c(\'POSIXct\', \'POSIXt\')), current = structure(list(sec = 41.1663863658905, min = 37L, hour = 1L, mday = 9L, mon = 9L, year = 114L, wday = 4L, yday = 281L, isdst = 1L, zone = \'EDT\', gmtoff = -14400L), .Names = c(\'sec\', \'min\', \'hour\', \'mday\', \'mon\', \'year\', \'wday\', \'yday\', \'isdst\', \'zone\', \'gmtoff\'), class = c(\'POSIXlt\', \'POSIXt\'), tzone = c(\'\', \'EST\', \'EDT\'))), .Names = c(\'target\', \'current\'));" + + "do.call(\'all.equal.POSIXt\', argv)"); + } } - diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinappend.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinappend.java index 58cbf07e9d..9709a85257 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinappend.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinappend.java @@ -2,9 +2,9 @@ * This material is distributed under the GNU General Public License * Version 2. You may review the terms of this license at * http://www.gnu.org/licenses/gpl-2.0.html - * + * * Copyright (c) 2014, Purdue University - * Copyright (c) 2014, Oracle and/or its affiliates + * Copyright (c) 2014, 2015, Oracle and/or its affiliates * All rights reserved. */ package com.oracle.truffle.r.test.testrgen; @@ -15,14 +15,10 @@ import com.oracle.truffle.r.test.*; // Checkstyle: stop line length check - public class TestrGenBuiltinappend extends TestBase { - - @Test - @Ignore - public void testappend1() { - assertEval("argv <- structure(list(x = 1:5, values = 0:1, after = 3), .Names = c(\'x\', \'values\', \'after\'));"+ - "do.call(\'append\', argv)"); - } +public class TestrGenBuiltinappend extends TestBase { + @Test + public void testappend1() { + assertEval("argv <- structure(list(x = 1:5, values = 0:1, after = 3), .Names = c(\'x\', \'values\', \'after\'));" + "do.call(\'append\', argv)"); + } } - diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinascomplex.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinascomplex.java index b90c62dc3d..222a6e219f 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinascomplex.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinascomplex.java @@ -2,9 +2,9 @@ * This material is distributed under the GNU General Public License * Version 2. You may review the terms of this license at * http://www.gnu.org/licenses/gpl-2.0.html - * + * * Copyright (c) 2014, Purdue University - * Copyright (c) 2014, Oracle and/or its affiliates + * Copyright (c) 2014, 2015, Oracle and/or its affiliates * * All rights reserved. */ @@ -51,7 +51,6 @@ public class TestrGenBuiltinascomplex extends TestBase { } @Test - @Ignore public void testascomplex7() { assertEval("argv <- list(NA_complex_);as.complex(argv[[1]]);"); } @@ -77,4 +76,3 @@ public class TestrGenBuiltinascomplex extends TestBase { assertEval("argv <- list(NULL, NULL);as.complex(argv[[1]],argv[[2]]);"); } } - diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinasinteger.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinasinteger.java index 1222d869cd..843588671e 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinasinteger.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinasinteger.java @@ -2,9 +2,9 @@ * This material is distributed under the GNU General Public License * Version 2. You may review the terms of this license at * http://www.gnu.org/licenses/gpl-2.0.html - * + * * Copyright (c) 2014, Purdue University - * Copyright (c) 2014, Oracle and/or its affiliates + * Copyright (c) 2014, 2015, Oracle and/or its affiliates * * All rights reserved. */ @@ -45,7 +45,6 @@ public class TestrGenBuiltinasinteger extends TestBase { } @Test - @Ignore public void testasinteger7() { assertEval("argv <- list(NULL);as.integer(argv[[1]]);"); } @@ -118,4 +117,3 @@ public class TestrGenBuiltinasinteger extends TestBase { assertEval("argv <- list(39);as.integer(argv[[1]]);"); } } - diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinasvector.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinasvector.java index 151c89cbb5..30e84e5c6b 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinasvector.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinasvector.java @@ -193,7 +193,6 @@ public class TestrGenBuiltinasvector extends TestBase { } @Test - @Ignore public void testasvector33() { assertEval("argv <- list(quote(list(cut(Dtimes, \'3 months\'))), \'list\'); .Internal(as.vector(argv[[1]], argv[[2]]))"); } @@ -410,7 +409,6 @@ public class TestrGenBuiltinasvector extends TestBase { } @Test - @Ignore public void testasvector76() { assertEval("argv <- list(structure(list(c0 = structure(character(0), class = \'AsIs\')), .Names = \'c0\', row.names = character(0), class = \'data.frame\'), \'character\'); .Internal(as.vector(argv[[1]], argv[[2]]))"); } diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinatan2.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinatan2.java index d3f60e7832..89ae757cd7 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinatan2.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinatan2.java @@ -2,9 +2,9 @@ * This material is distributed under the GNU General Public License * Version 2. You may review the terms of this license at * http://www.gnu.org/licenses/gpl-2.0.html - * + * * Copyright (c) 2014, Purdue University - * Copyright (c) 2014, Oracle and/or its affiliates + * Copyright (c) 2014, 2015, Oracle and/or its affiliates * * All rights reserved. */ @@ -30,7 +30,6 @@ public class TestrGenBuiltinatan2 extends TestBase { } @Test - @Ignore public void testatan23() { assertEval("argv <- list(c(-1.95681154249341, -2.88854075894443, -2.84850921846233, -2.14635417317387, -1.72790445779804, -0.92649412488672, -0.261537463816701, 0.948205247045638, 1.0990096500205, 2.09024037060933, 2.90928417418961, 4.00425294069879, 1.70515935701163), c(-3.2406391957027, -2.61163262017643, -0.21977838696678, 1.24931893031091, 1.6032898858835, 2.16902716372255, 2.15792786802985, 2.10075226013806, 2.04989923648162, 1.49269068253165, 0.515893014329757, -2.61745072267338, -4.64929811590859)); .Internal(atan2(argv[[1]], argv[[2]]))"); } @@ -48,9 +47,7 @@ public class TestrGenBuiltinatan2 extends TestBase { } @Test - @Ignore public void testatan26() { assertEval("argv <- list(logical(0), logical(0)); .Internal(atan2(argv[[1]], argv[[2]]))"); } } - diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltincharToRaw.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltincharToRaw.java index 9cd0028f3f..ec562a5178 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltincharToRaw.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltincharToRaw.java @@ -2,9 +2,9 @@ * This material is distributed under the GNU General Public License * Version 2. You may review the terms of this license at * http://www.gnu.org/licenses/gpl-2.0.html - * + * * Copyright (c) 2014, Purdue University - * Copyright (c) 2014, Oracle and/or its affiliates + * Copyright (c) 2014, 2015, Oracle and/or its affiliates * * All rights reserved. */ @@ -18,9 +18,7 @@ import com.oracle.truffle.r.test.*; public class TestrGenBuiltincharToRaw extends TestBase { @Test - @Ignore public void testcharToRaw1() { assertEval("argv <- list(\'\'); .Internal(charToRaw(argv[[1]]))"); } } - diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinexists.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinexists.java index c90c244e1a..024931c1c5 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinexists.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinexists.java @@ -2,9 +2,9 @@ * This material is distributed under the GNU General Public License * Version 2. You may review the terms of this license at * http://www.gnu.org/licenses/gpl-2.0.html - * + * * Copyright (c) 2014, Purdue University - * Copyright (c) 2014, Oracle and/or its affiliates + * Copyright (c) 2014, 2015, Oracle and/or its affiliates * All rights reserved. */ package com.oracle.truffle.r.test.testrgen; @@ -15,14 +15,10 @@ import com.oracle.truffle.r.test.*; // Checkstyle: stop line length check - public class TestrGenBuiltinexists extends TestBase { - - @Test - @Ignore - public void testexists1() { - assertEval("argv <- structure(list(x = \'.Device\'), .Names = \'x\');"+ - "do.call(\'exists\', argv)"); - } +public class TestrGenBuiltinexists extends TestBase { + @Test + public void testexists1() { + assertEval("argv <- structure(list(x = \'.Device\'), .Names = \'x\');" + "do.call(\'exists\', argv)"); + } } - diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinextract_parentasis_assign_factor.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinextract_parentasis_assign_factor.java index a1da45250c..ab2be98972 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinextract_parentasis_assign_factor.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinextract_parentasis_assign_factor.java @@ -2,9 +2,9 @@ * This material is distributed under the GNU General Public License * Version 2. You may review the terms of this license at * http://www.gnu.org/licenses/gpl-2.0.html - * + * * Copyright (c) 2014, Purdue University - * Copyright (c) 2014, Oracle and/or its affiliates + * Copyright (c) 2014, 2015, Oracle and/or its affiliates * All rights reserved. */ package com.oracle.truffle.r.test.testrgen; @@ -15,14 +15,11 @@ import com.oracle.truffle.r.test.*; // Checkstyle: stop line length check - public class TestrGenBuiltinextract_parentasis_assign_factor extends TestBase { - - @Test - @Ignore - public void testextract_parentasis_assign_factor1() { - assertEval("argv <- structure(list(x = structure(c(4L, 1L, 4L, 4L, 6L, 4L, 5L, 5L, 4L, 6L, 6L, 2L, 3L, 6L, 4L, 2L, 1L, 6L, 1L, 3L, 3L, 5L, 2L, 2L, 2L, 5L, 3L, 3L, 1L, 2L, 5L, 6L, 6L, 6L, 6L, 2L, 6L, 1L, 5L, 1L, 2L, 4L, 4L, 6L, 5L, 5L, 2L, 6L, 4L, 6L, 5L, 1L, 2L, 5L, 1L, 1L, 4L, 3L, 3L, 4L, 4L, 2L, 5L, 3L, 4L, 5L, 4L, 6L, 4L, 5L, 2L, 6L, 2L, 4L, 2L, 2L, 4L, 4L, 1L, 6L, 2L, 1L, 5L, 3L, 5L, 1L, 2L, 2L, 4L, 2L, 4L, 2L, 5L, 6L, 5L, 6L, 3L, 1L, 2L, 4L, 6L, 6L, 3L, 3L, 2L, 6L, 2L, 5L, 3L, 4L, 3L, 4L, 6L, 3L, 4L, 2L, 3L, 1L, 6L, 2L, 4L, 4L, 1L, 3L, 4L, 3L, 4L, 1L, 4L, 1L, 3L, 5L, 5L, 5L, 4L, 4L, 6L, 2L, 6L, 3L, 2L, 1L, 1L, 6L, 2L, 2L, 5L, 1L, 5L, 3L, 2L, 2L, 5L, 1L, 6L, 3L, 6L, 4L, 2L, 2L, 5L, 6L, 6L, 1L, 1L, 6L, 6L, 5L, 2L, 5L, 6L, 5L, 4L, 6L, 2L, 5L, 4L, 3L, 5L, 1L, 3L, 4L, 4L, 3L, 1L, 1L, 5L, 4L, 1L, 3L, 5L, 4L, 5L, 4L, 6L, 6L, 2L, 4L, 3L, 3L), .Label = c(\'a\', \'b\', \'c\', \'d\', \'e\', \'f\'), class = \'factor\'), c(189L, 84L, 154L, 9L, 130L, 44L, 137L, 12L, 50L, 1L, 42L, 174L, 194L, 131L, 157L, 101L, 37L, 128L, 117L, 181L, 51L, 109L, 110L, 67L, 69L, 124L, 192L, 65L, 171L, 168L), value = NA), .Names = c(\'x\', \'\', \'value\'));"+ - "do.call(\'[<-.factor\', argv)"); - } +public class TestrGenBuiltinextract_parentasis_assign_factor extends TestBase { + @Test + public void testextract_parentasis_assign_factor1() { + assertEval("argv <- structure(list(x = structure(c(4L, 1L, 4L, 4L, 6L, 4L, 5L, 5L, 4L, 6L, 6L, 2L, 3L, 6L, 4L, 2L, 1L, 6L, 1L, 3L, 3L, 5L, 2L, 2L, 2L, 5L, 3L, 3L, 1L, 2L, 5L, 6L, 6L, 6L, 6L, 2L, 6L, 1L, 5L, 1L, 2L, 4L, 4L, 6L, 5L, 5L, 2L, 6L, 4L, 6L, 5L, 1L, 2L, 5L, 1L, 1L, 4L, 3L, 3L, 4L, 4L, 2L, 5L, 3L, 4L, 5L, 4L, 6L, 4L, 5L, 2L, 6L, 2L, 4L, 2L, 2L, 4L, 4L, 1L, 6L, 2L, 1L, 5L, 3L, 5L, 1L, 2L, 2L, 4L, 2L, 4L, 2L, 5L, 6L, 5L, 6L, 3L, 1L, 2L, 4L, 6L, 6L, 3L, 3L, 2L, 6L, 2L, 5L, 3L, 4L, 3L, 4L, 6L, 3L, 4L, 2L, 3L, 1L, 6L, 2L, 4L, 4L, 1L, 3L, 4L, 3L, 4L, 1L, 4L, 1L, 3L, 5L, 5L, 5L, 4L, 4L, 6L, 2L, 6L, 3L, 2L, 1L, 1L, 6L, 2L, 2L, 5L, 1L, 5L, 3L, 2L, 2L, 5L, 1L, 6L, 3L, 6L, 4L, 2L, 2L, 5L, 6L, 6L, 1L, 1L, 6L, 6L, 5L, 2L, 5L, 6L, 5L, 4L, 6L, 2L, 5L, 4L, 3L, 5L, 1L, 3L, 4L, 4L, 3L, 1L, 1L, 5L, 4L, 1L, 3L, 5L, 4L, 5L, 4L, 6L, 6L, 2L, 4L, 3L, 3L), .Label = c(\'a\', \'b\', \'c\', \'d\', \'e\', \'f\'), class = \'factor\'), c(189L, 84L, 154L, 9L, 130L, 44L, 137L, 12L, 50L, 1L, 42L, 174L, 194L, 131L, 157L, 101L, 37L, 128L, 117L, 181L, 51L, 109L, 110L, 67L, 69L, 124L, 192L, 65L, 171L, 168L), value = NA), .Names = c(\'x\', \'\', \'value\'));" + + "do.call(\'[<-.factor\', argv)"); + } } - diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinextract_parentasis_extract_parentasis_assign_factor.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinextract_parentasis_extract_parentasis_assign_factor.java index a2972ca78d..c717e86f99 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinextract_parentasis_extract_parentasis_assign_factor.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinextract_parentasis_extract_parentasis_assign_factor.java @@ -2,9 +2,9 @@ * This material is distributed under the GNU General Public License * Version 2. You may review the terms of this license at * http://www.gnu.org/licenses/gpl-2.0.html - * + * * Copyright (c) 2014, Purdue University - * Copyright (c) 2014, Oracle and/or its affiliates + * Copyright (c) 2014, 2015, Oracle and/or its affiliates * All rights reserved. */ package com.oracle.truffle.r.test.testrgen; @@ -15,14 +15,11 @@ import com.oracle.truffle.r.test.*; // Checkstyle: stop line length check - public class TestrGenBuiltinextract_parentasis_extract_parentasis_assign_factor extends TestBase { - - @Test - @Ignore - public void testextract_parentasis_extract_parentasis_assign_factor1() { - assertEval("argv <- structure(list(x = structure(c(2L, 2L, 3L), .Label = c(\'One\', \'Two\', \'Three\'), class = \'factor\'), 2, value = \'One\'), .Names = c(\'x\', \'\', \'value\'));"+ - "do.call(\'[[<-.factor\', argv)"); - } +public class TestrGenBuiltinextract_parentasis_extract_parentasis_assign_factor extends TestBase { + @Test + public void testextract_parentasis_extract_parentasis_assign_factor1() { + assertEval("argv <- structure(list(x = structure(c(2L, 2L, 3L), .Label = c(\'One\', \'Two\', \'Three\'), class = \'factor\'), 2, value = \'One\'), .Names = c(\'x\', \'\', \'value\'));" + + "do.call(\'[[<-.factor\', argv)"); + } } - diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltingsub.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltingsub.java index 4d650e6a4d..e4e40c9117 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltingsub.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltingsub.java @@ -156,7 +156,6 @@ public class TestrGenBuiltingsub extends TestBase { } @Test - @Ignore public void testgsub25() { assertEval("argv <- list(\'%\', \'\\\\\\\\%\', structure(\'foo\', .Names = \'object\'), FALSE, FALSE, FALSE, FALSE); .Internal(gsub(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]]))"); } @@ -168,7 +167,6 @@ public class TestrGenBuiltingsub extends TestBase { } @Test - @Ignore public void testgsub27() { assertEval("argv <- list(\'.__T__(.*):([^:]+(.*))\', \'\\\\2\', c(\'.__T__!:base\', \'.__T__%%:base\', \'.__T__%*%:base\', \'.__T__%/%:base\', \'.__T__&:base\', \'.__T__*:base\', \'.__T__+:base\', \'.__T__-:base\', \'.__T__/:base\', \'.__T__Arith:base\', \'.__T__BunchKaufman:Matrix\', \'.__T__Cholesky:Matrix\', \'.__T__Compare:methods\', \'.__T__Logic:base\', \'.__T__Math2:methods\', \'.__T__Math:base\', \'.__T__Ops:base\', \'.__T__Schur:Matrix\', \'.__T__Summary:base\', \'.__T__[:base\', \'.__T__[<-:base\', \'.__T__^:base\', \'.__T__all.equal:base\', \'.__T__all:base\', \'.__T__any:base\', \'.__T__as.array:base\', \'.__T__as.integer:base\', \'.__T__as.logical:base\', \'.__T__as.matrix:base\', \'.__T__as.numeric:base\', \'.__T__as.vector:base\', \'.__T__band:Matrix\', \'.__T__cbind2:methods\', \'.__T__chol2inv:base\', \'.__T__chol:base\', \'.__T__coerce:methods\', \'.__T__coerce<-:methods\', \'.__T__colMeans:base\', \'.__T__colSums:base\', \'.__T__cov2cor:stats\', \'.__T__crossprod:base\', \'.__T__determinant:base\', \'.__T__diag:base\', \'.__T__diag<-:base\', \'.__T__diff:base\', \'.__T__dim:base\', \'.__T__dim<-:base\', \'.__T__dimnames:base\', \'.__T__dimnames<-:base\', \'.__T__drop:base\', \'.__T__expand:Matrix\', \'.__T__expm:Matrix\', \'.__T__facmul:Matrix\', \'.__T__forceSymmetric:Matrix\', \'.__T__format:base\', \'.__T__head:utils\', \'.__T__image:graphics\', \'.__T__initialize:methods\', \'.__T__is.finite:base\', \'.__T__is.infinite:base\', \'.__T__is.na:base\', \'.__T__isDiagonal:Matrix\', \'.__T__isSymmetric:base\', \'.__T__isTriangular:Matrix\', \'.__T__kronecker:base\', \'.__T__length:base\', \'.__T__lu:Matrix\', \'.__T__mean:base\', \'.__T__nnzero:Matrix\', \'.__T__norm:base\', \'.__T__pack:Matrix\', \'.__T__print:base\', \'.__T__prod:base\', \'.__T__qr.Q:base\', \'.__T__qr.R:base\', \'.__T__qr.coef:base\', \'.__T__qr.fitted:base\', \'.__T__qr.qty:base\', \'.__T__qr.qy:base\', \'.__T__qr.resid:base\', \'.__T__qr:base\', \'.__T__rbind2:methods\', \'.__T__rcond:base\', \'.__T__rep:base\', \'.__T__rowMeans:base\', \'.__T__rowSums:base\', \'.__T__show:methods\', \'.__T__skewpart:Matrix\', \'.__T__solve:base\', \'.__T__sum:base\', \'.__T__summary:base\', \'.__T__symmpart:Matrix\', \'.__T__t:base\', \'.__T__tail:utils\', \'.__T__tcrossprod:base\', \'.__T__toeplitz:stats\', \'.__T__tril:Matrix\', \'.__T__triu:Matrix\', \'.__T__unname:base\', \'.__T__unpack:Matrix\', \'.__T__update:stats\', \'.__T__updown:Matrix\', \'.__T__which:base\', \'.__T__writeMM:Matrix\', \'.__T__zapsmall:base\'), FALSE, FALSE, FALSE, FALSE); .Internal(gsub(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]]))"); } diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltiniscomplex.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltiniscomplex.java index fd324b0314..5f45a2832c 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltiniscomplex.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltiniscomplex.java @@ -33,7 +33,6 @@ public class TestrGenBuiltiniscomplex extends TestBase { } @Test - @Ignore public void testiscomplex4() { assertEval("argv <- list(NA_complex_);is.complex(argv[[1]]);"); } diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinisna.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinisna.java index 9c1d52e03d..b19d8d58ef 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinisna.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinisna.java @@ -192,7 +192,6 @@ public class TestrGenBuiltinisna extends TestBase { } @Test - @Ignore public void testisna35() { assertEval("argv <- list(NA_complex_);is.na(argv[[1]]);"); } diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinisnull.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinisnull.java index 102bec467c..c14c3b443d 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinisnull.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinisnull.java @@ -2,9 +2,9 @@ * This material is distributed under the GNU General Public License * Version 2. You may review the terms of this license at * http://www.gnu.org/licenses/gpl-2.0.html - * + * * Copyright (c) 2014, Purdue University - * Copyright (c) 2014, Oracle and/or its affiliates + * Copyright (c) 2014, 2015, Oracle and/or its affiliates * * All rights reserved. */ @@ -77,27 +77,20 @@ public class TestrGenBuiltinisnull extends TestBase { assertEval("argv <- list(structure(3.14159265358979, class = structure(\'3.14159265358979\', class = \'testit\')));is.null(argv[[1]]);"); } - @Test - @Ignore - public void testisnull14() { - assertEval("argv <- list(NA_complex_);"+ - "do.call(\'is.null\', argv)"); - } - - - @Test - public void testisnull15() { - assertEval("argv <- list(complex(real = 3, imaginary = -Inf));"+ - "do.call(\'is.null\', argv)"); - } + @Test + public void testisnull14() { + assertEval("argv <- list(NA_complex_);" + "do.call(\'is.null\', argv)"); + } + @Test + public void testisnull15() { + assertEval("argv <- list(complex(real = 3, imaginary = -Inf));" + "do.call(\'is.null\', argv)"); + } - @Test + @Test @Ignore - public void testisnull16() { - assertEval("argv <- list(function(file = ifelse(onefile, \'Rplots.pdf\', \'Rplot%03d.pdf\'), width, height, onefile, family, title, fonts, version, paper, encoding, bg, fg, pointsize, pagecentre, colormodel, useDingbats, useKerning, fillOddEven, compress) { initPSandPDFfonts() new <- list() if (!missing(width)) new$width <- width if (!missing(height)) new$height <- height if (!missing(onefile)) new$onefile <- onefile if (!missing(title)) new$title <- title if (!missing(fonts)) new$fonts <- fonts if (!missing(version)) new$version <- version if (!missing(paper)) new$paper <- paper if (!missing(encoding)) new$encoding <- encoding if (!missing(bg)) new$bg <- bg if (!missing(fg)) new$fg <- fg if (!missing(pointsize)) new$pointsize <- pointsize if (!missing(pagecentre)) new$pagecentre <- pagecentre if (!missing(colormodel)) new$colormodel <- colormodel if (!missing(useDingbats)) new$useDingbats <- useDingbats if (!missing(useKerning)) new$useKerning <- useKerning if (!missing(fillOddEven)) new$fillOddEven <- fillOddEven if (!missing(compress)) new$compress <- compress old <- check.options(new, name.opt = \'.PDF.Options\', envir = .PSenv) if (!missing(family) && (inherits(family, \'Type1Font\') || inherits(family, \'CIDFont\'))) { enc <- family$encoding if (inherits(family, \'Type1Font\') && !is.null(enc) && enc != \'default\' && (is.null(old$encoding) || old$encoding == \'default\')) old$encoding <- enc family <- family$metrics } if (is.null(old$encoding) || old$encoding == \'default\') old$encoding <- guessEncoding() if (!missing(family)) { if (length(family) == 4L) { family <- c(family, \'Symbol.afm\') } else if (length(family) == 5L) { } else if (length(family) == 1L) { pf <- pdfFonts(family)[[1L]] if (is.null(pf)) stop(gettextf(\'unknown family '%s'\', family), domain = NA) matchFont(pf, old$encoding) } else stop(\'invalid 'family' argument\') old$family <- family } version <- old$version versions <- c(\'1.1\', \'1.2\', \'1.3\', \'1.4\', \'1.5\', \'1.6\', \'1.7\', \'2.0\') if (version %in% versions) version <- as.integer(strsplit(version, \'[.]\')[[1L]]) else stop(\'invalid PDF version\') onefile <- old$onefile if (!checkIntFormat(file)) stop(gettextf(\'invalid 'file' argument '%s'\', file), domain = NA) .External(C_PDF, file, old$paper, old$family, old$encoding, old$bg, old$fg, old$width, old$height, old$pointsize, onefile, old$pagecentre, old$title, old$fonts, version[1L], version[2L], old$colormodel, old$useDingbats, old$useKerning, old$fillOddEven, old$compress) invisible()});"+ - "do.call(\'is.null\', argv)"); - } - + public void testisnull16() { + assertEval("argv <- list(function(file = ifelse(onefile, \'Rplots.pdf\', \'Rplot%03d.pdf\'), width, height, onefile, family, title, fonts, version, paper, encoding, bg, fg, pointsize, pagecentre, colormodel, useDingbats, useKerning, fillOddEven, compress) { initPSandPDFfonts() new <- list() if (!missing(width)) new$width <- width if (!missing(height)) new$height <- height if (!missing(onefile)) new$onefile <- onefile if (!missing(title)) new$title <- title if (!missing(fonts)) new$fonts <- fonts if (!missing(version)) new$version <- version if (!missing(paper)) new$paper <- paper if (!missing(encoding)) new$encoding <- encoding if (!missing(bg)) new$bg <- bg if (!missing(fg)) new$fg <- fg if (!missing(pointsize)) new$pointsize <- pointsize if (!missing(pagecentre)) new$pagecentre <- pagecentre if (!missing(colormodel)) new$colormodel <- colormodel if (!missing(useDingbats)) new$useDingbats <- useDingbats if (!missing(useKerning)) new$useKerning <- useKerning if (!missing(fillOddEven)) new$fillOddEven <- fillOddEven if (!missing(compress)) new$compress <- compress old <- check.options(new, name.opt = \'.PDF.Options\', envir = .PSenv) if (!missing(family) && (inherits(family, \'Type1Font\') || inherits(family, \'CIDFont\'))) { enc <- family$encoding if (inherits(family, \'Type1Font\') && !is.null(enc) && enc != \'default\' && (is.null(old$encoding) || old$encoding == \'default\')) old$encoding <- enc family <- family$metrics } if (is.null(old$encoding) || old$encoding == \'default\') old$encoding <- guessEncoding() if (!missing(family)) { if (length(family) == 4L) { family <- c(family, \'Symbol.afm\') } else if (length(family) == 5L) { } else if (length(family) == 1L) { pf <- pdfFonts(family)[[1L]] if (is.null(pf)) stop(gettextf(\'unknown family '%s'\', family), domain = NA) matchFont(pf, old$encoding) } else stop(\'invalid 'family' argument\') old$family <- family } version <- old$version versions <- c(\'1.1\', \'1.2\', \'1.3\', \'1.4\', \'1.5\', \'1.6\', \'1.7\', \'2.0\') if (version %in% versions) version <- as.integer(strsplit(version, \'[.]\')[[1L]]) else stop(\'invalid PDF version\') onefile <- old$onefile if (!checkIntFormat(file)) stop(gettextf(\'invalid 'file' argument '%s'\', file), domain = NA) .External(C_PDF, file, old$paper, old$family, old$encoding, old$bg, old$fg, old$width, old$height, old$pointsize, onefile, old$pagecentre, old$title, old$fonts, version[1L], version[2L], old$colormodel, old$useDingbats, old$useKerning, old$fillOddEven, old$compress) invisible()});" + + "do.call(\'is.null\', argv)"); + } } - diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinlabels.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinlabels.java index 5224f0eccf..74ebabdceb 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinlabels.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinlabels.java @@ -2,9 +2,9 @@ * This material is distributed under the GNU General Public License * Version 2. You may review the terms of this license at * http://www.gnu.org/licenses/gpl-2.0.html - * + * * Copyright (c) 2014, Purdue University - * Copyright (c) 2014, Oracle and/or its affiliates + * Copyright (c) 2014, 2015, Oracle and/or its affiliates * All rights reserved. */ package com.oracle.truffle.r.test.testrgen; @@ -15,14 +15,11 @@ import com.oracle.truffle.r.test.*; // Checkstyle: stop line length check - public class TestrGenBuiltinlabels extends TestBase { - - @Test - @Ignore - public void testlabels1() { - assertEval("argv <- structure(list(object = structure(c(-469.098459411633, 469.356672501203, -0.429918004252249, 0.00364370239091614, -0.256875513692359, -0.0204799335117722, 2.00613934942808), .Names = c(\'(Intercept)\', \'gravity\', \'ph\', \'osmo\', \'conduct\', \'urea\', \'log(calc)\'))), .Names = \'object\');"+ - "do.call(\'labels\', argv)"); - } +public class TestrGenBuiltinlabels extends TestBase { + @Test + public void testlabels1() { + assertEval("argv <- structure(list(object = structure(c(-469.098459411633, 469.356672501203, -0.429918004252249, 0.00364370239091614, -0.256875513692359, -0.0204799335117722, 2.00613934942808), .Names = c(\'(Intercept)\', \'gravity\', \'ph\', \'osmo\', \'conduct\', \'urea\', \'log(calc)\'))), .Names = \'object\');" + + "do.call(\'labels\', argv)"); + } } - diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinmatrix.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinmatrix.java index 9c86e30cd9..1211fc1753 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinmatrix.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinmatrix.java @@ -157,7 +157,6 @@ public class TestrGenBuiltinmatrix extends TestBase { } @Test - @Ignore public void testmatrix28() { assertEval("argv <- list(NA_complex_, 5L, 1L, FALSE, NULL, FALSE, FALSE); .Internal(matrix(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]]))"); } diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinmean.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinmean.java index db3036ac73..1745cede5e 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinmean.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinmean.java @@ -106,7 +106,6 @@ public class TestrGenBuiltinmean extends TestBase { } @Test - @Ignore public void testmean19() { assertEval("argv <- structure(list(x = structure(c(31, NA, NA, 31), units = \'days\', class = \'difftime\'), na.rm = TRUE), .Names = c(\'x\', \'na.rm\'));" + "do.call(\'mean\', argv)"); } diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinoperators.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinoperators.java index cd88068c34..33bdda0442 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinoperators.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinoperators.java @@ -289,7 +289,6 @@ public class TestrGenBuiltinoperators extends TestBase { } @Test - @Ignore public void testoperators51() { assertEval("argv <- list(structure(c(94694400, 126230400, 157766400, 189302400, 220924800, 252460800, 283996800, 315532800, 362793600, 394329600, 425865600, 489024000, 567993600, 631152000, 662688000, 709948800, 741484800, 773020800, 820454400, 867715200, 915148800, 1136073600, 1230768000, 1341100800), class = c(\'POSIXct\', \'POSIXt\')), structure(c(78796800, 94694400, 126230400, 157766400, 189302400, 220924800, 252460800, 283996800, 315532800, 362793600, 394329600, 425865600, 489024000, 567993600, 631152000, 662688000, 709948800, 741484800, 773020800, 820454400, 867715200, 1136073600, 1230768000, 1341100800), class = c(\'POSIXct\', \'POSIXt\')));`-`(argv[[1]],argv[[2]]);"); } @@ -354,7 +353,6 @@ public class TestrGenBuiltinoperators extends TestBase { } @Test - @Ignore public void testoperators63() { assertEval("argv <- list(structure(list(war = c(1L, 1L, 2L, 1L, 2L, 2L, 2L, 2L, 2L, 1L, 1L, 1L, 2L, 1L, 1L, 2L, 2L, 1L, 1L, 2L), fly = c(1L, 2L, 1L, 1L, 1L, 1L, 2L, 2L, 1L, 2L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L), ver = c(1L, 1L, 2L, 1L, 2L, 2L, 2L, 2L, 2L, 1L, 2L, 2L, 2L, 2L, 1L, 2L, 2L, 2L, 1L, 2L), end = c(1L, 1L, 1L, 1L, 2L, 1L, 1L, 2L, 2L, 1L, 2L, 1L, NA, 1L, 1L, 2L, 1L, 1L, NA, 2L), gro = c(2L, 2L, 1L, 1L, 2L, 2L, 2L, 1L, 2L, 1L, NA, 2L, 2L, 1L, NA, 2L, 2L, NA, 1L, 2L), hai = c(1L, 2L, 2L, 2L, 2L, 2L, 1L, 1L, 1L, 1L, 1L, 1L, 2L, 1L, 1L, 2L, 2L, 1L, 2L, 1L)), .Names = c(\'war\', \'fly\', \'ver\', \'end\', \'gro\', \'hai\'), class = \'data.frame\', row.names = c(\'ant\', \'bee\', \'cat\', \'cpl\', \'chi\', \'cow\', \'duc\', \'eag\', \'ele\', \'fly\', \'fro\', \'her\', \'lio\', \'liz\', \'lob\', \'man\', \'rab\', \'sal\', \'spi\', \'wha\')), 1);`-`(argv[[1]],argv[[2]]);"); } @@ -602,7 +600,6 @@ public class TestrGenBuiltinoperators extends TestBase { } @Test - @Ignore public void testoperators110() { assertEval("argv <- list(structure(list(Fertility = c(80.2, 83.1, 92.5, 85.8, 76.9), Agriculture = c(17, 45.1, 39.7, 36.5, 43.5), Examination = c(15L, 6L, 5L, 12L, 17L), Education = c(12L, 9L, 5L, 7L, 15L)), .Names = c(\'Fertility\', \'Agriculture\', \'Examination\', \'Education\'), row.names = c(\'Courtelary\', \'Delemont\', \'Franches-Mnt\', \'Moutier\', \'Neuveville\'), class = \'data.frame\'), 6);`<=`(argv[[1]],argv[[2]]);"); } @@ -689,7 +686,6 @@ public class TestrGenBuiltinoperators extends TestBase { } @Test - @Ignore public void testoperators126() { assertEval("argv <- list(structure(list(cde = 2L, cd = 4L), .Names = c(\'cde\', \'cd\'), row.names = \'ab\', class = \'data.frame\'), c(2, 4));`==`(argv[[1]],argv[[2]]);"); } @@ -1039,7 +1035,6 @@ public class TestrGenBuiltinoperators extends TestBase { } @Test - @Ignore public void testoperators192() { assertEval("argv <- list(structure(c(TRUE, FALSE, FALSE, FALSE, FALSE, TRUE, TRUE, TRUE, TRUE, NA), .Dim = c(5L, 2L), .Dimnames = list(NULL, c(\'VAR1\', \'VAR3\'))), structure(c(TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, TRUE, FALSE), .Dim = c(5L, 2L), .Dimnames = list(NULL, c(\'VAR1\', \'VAR3\'))));`&`(argv[[1]],argv[[2]]);"); } @@ -1392,7 +1387,6 @@ public class TestrGenBuiltinoperators extends TestBase { } @Test - @Ignore public void testoperators261() { assertEval("argv <- list(structure(list(VAR1 = c(1, 2, 3, 4, 5), VAR3 = c(1, 1, 1, 1, NA)), .Names = c(\'VAR1\', \'VAR3\'), class = \'data.frame\', row.names = c(NA, -5L)), 1);`==`(argv[[1]],argv[[2]]);"); } @@ -1668,7 +1662,6 @@ public class TestrGenBuiltinoperators extends TestBase { } @Test - @Ignore public void testoperators313() { assertEval("argv <- list(structure(c(NA, FALSE, TRUE, NA, FALSE, TRUE, NA, FALSE, TRUE), .Names = c(NA, \'FALSE\', \'TRUE\', NA, \'FALSE\', \'TRUE\', NA, \'FALSE\', \'TRUE\')), structure(c(NA, NA, NA, FALSE, FALSE, FALSE, TRUE, TRUE, TRUE), .Names = c(NA, NA, NA, \'FALSE\', \'FALSE\', \'FALSE\', \'TRUE\', \'TRUE\', \'TRUE\')));`|`(argv[[1]],argv[[2]]);"); } @@ -1803,7 +1796,6 @@ public class TestrGenBuiltinoperators extends TestBase { } @Test - @Ignore public void testoperators337() { assertEval("argv <- list(c(TRUE, TRUE, TRUE, FALSE, TRUE, TRUE, TRUE, FALSE), c(TRUE, TRUE, TRUE, NA, FALSE, FALSE, TRUE, NA));`&`(argv[[1]],argv[[2]]);"); } @@ -1831,7 +1823,6 @@ public class TestrGenBuiltinoperators extends TestBase { } @Test - @Ignore public void testoperators342() { assertEval("argv <- list(structure(c(NA, FALSE, TRUE, NA, FALSE, TRUE, NA, FALSE, TRUE), .Names = c(NA, \'FALSE\', \'TRUE\', NA, \'FALSE\', \'TRUE\', NA, \'FALSE\', \'TRUE\')), structure(c(NA, NA, NA, FALSE, FALSE, FALSE, TRUE, TRUE, TRUE), .Names = c(NA, NA, NA, \'FALSE\', \'FALSE\', \'FALSE\', \'TRUE\', \'TRUE\', \'TRUE\')));`&`(argv[[1]],argv[[2]]);"); } diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinprintfunction.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinprintfunction.java index 3c91312f35..4dd3077115 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinprintfunction.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinprintfunction.java @@ -2,9 +2,9 @@ * This material is distributed under the GNU General Public License * Version 2. You may review the terms of this license at * http://www.gnu.org/licenses/gpl-2.0.html - * + * * Copyright (c) 2014, Purdue University - * Copyright (c) 2014, Oracle and/or its affiliates + * Copyright (c) 2014, 2015, Oracle and/or its affiliates * * All rights reserved. */ @@ -36,7 +36,6 @@ public class TestrGenBuiltinprintfunction extends TestBase { } @Test - @Ignore public void testprintfunction4() { assertEval("argv <- list(.Primitive(\'.Internal\'), TRUE); .Internal(print.function(argv[[1]], argv[[2]]))"); } @@ -47,4 +46,3 @@ public class TestrGenBuiltinprintfunction extends TestBase { assertEval("argv <- list(.Primitive(\'log\'), TRUE); .Internal(print.function(argv[[1]], argv[[2]]))"); } } - diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinsep.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinsep.java index 280515f6db..76bdfee263 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinsep.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinsep.java @@ -90,7 +90,6 @@ public class TestrGenBuiltinsep extends TestBase { } @Test - @Ignore public void testsep14() { assertEval("argv <- list(structure(list(A = c(52L, 52L, 47L, 45L, 40L, 37L, 27L, 27L, 23L, 22L, 21L, 25L, 24L, 22L, 22L, 20L, 16L, 17L, 14L, 13L, 13L, 14L, 24L), F = c(42L, 44L, 48L, 49L, 50L, 54L, 58L, 54L, 59L, 59L, 60L, 53L, 54L, 55L, 56L, 58L, 62L, 57L, 54L, 55L, 52L, 47L, 56L), M = c(6L, 4L, 5L, 6L, 10L, 9L, 15L, 19L, 18L, 19L, 19L, 22L, 22L, 23L, 22L, 22L, 22L, 26L, 32L, 32L, 35L, 39L, 20L)), .Names = c(\'A\', \'F\', \'M\'), class = \'data.frame\', row.names = c(NA, 23L)), 100);`/`(argv[[1]],argv[[2]]);"); } diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinsink.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinsink.java index 0bf3dedaa9..a655405440 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinsink.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinsink.java @@ -2,9 +2,9 @@ * This material is distributed under the GNU General Public License * Version 2. You may review the terms of this license at * http://www.gnu.org/licenses/gpl-2.0.html - * + * * Copyright (c) 2014, Purdue University - * Copyright (c) 2014, Oracle and/or its affiliates + * Copyright (c) 2014, 2015, Oracle and/or its affiliates * * All rights reserved. */ @@ -18,7 +18,6 @@ import com.oracle.truffle.r.test.*; public class TestrGenBuiltinsink extends TestBase { @Test - @Ignore public void testsink1() { assertEval("argv <- list(structure(2L, class = c(\'terminal\', \'connection\')), FALSE, TRUE, FALSE); .Internal(sink(argv[[1]], argv[[2]], argv[[3]], argv[[4]]))"); } @@ -29,4 +28,3 @@ public class TestrGenBuiltinsink extends TestBase { assertEval("argv <- list(-1L, FALSE, FALSE, FALSE); .Internal(sink(argv[[1]], argv[[2]], argv[[3]], argv[[4]]))"); } } - diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinsinknumber.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinsinknumber.java index 1f61c5933d..fbcb2b8998 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinsinknumber.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinsinknumber.java @@ -2,9 +2,9 @@ * This material is distributed under the GNU General Public License * Version 2. You may review the terms of this license at * http://www.gnu.org/licenses/gpl-2.0.html - * + * * Copyright (c) 2014, Purdue University - * Copyright (c) 2014, Oracle and/or its affiliates + * Copyright (c) 2014, 2015, Oracle and/or its affiliates * * All rights reserved. */ @@ -18,9 +18,7 @@ import com.oracle.truffle.r.test.*; public class TestrGenBuiltinsinknumber extends TestBase { @Test - @Ignore public void testsinknumber1() { assertEval("argv <- list(FALSE); .Internal(sink.number(argv[[1]]))"); } } - diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinsplit.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinsplit.java index c1381042f4..fa303e1759 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinsplit.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinsplit.java @@ -52,7 +52,6 @@ public class TestrGenBuiltinsplit extends TestBase { } @Test - @Ignore public void testsplit7() { assertEval("argv <- list(structure(c(\'Sex/(Age + Eth * Lrn)\', \'Sex + Sex:Age + Sex:Eth + Sex:Lrn + Sex:Eth:Lrn + Sex:Age:Lrn\', \'Sex + Sex:Age + Sex:Eth + Sex:Lrn + Sex:Eth:Lrn + Sex:Age:Lrn + Sex:Age:Eth + Sex:Age:Eth:Lrn\', \'1.597991\', \'1.686899\', \'1.928360\', \'132\', \'128\', \'118\', \'-1063.025\', \'-1055.398\', \'-1039.324\', \'\', \'1 vs 2\', \'2 vs 3\', \'\', \' 4\', \'10\', \'\', \' 7.627279\', \'16.073723\', \'\', \'0.10622602\', \'0.09754136\'), .Dim = c(3L, 8L)), structure(c(1L, 1L, 1L, 2L, 2L, 2L, 3L, 3L, 3L, 4L, 4L, 4L, 5L, 5L, 5L, 6L, 6L, 6L, 7L, 7L, 7L, 8L, 8L, 8L), .Label = c(\'1\', \'2\', \'3\', \'4\', \'5\', \'6\', \'7\', \'8\'), class = \'factor\')); .Internal(split(argv[[1]], argv[[2]]))"); } @@ -63,7 +62,6 @@ public class TestrGenBuiltinsplit extends TestBase { } @Test - @Ignore public void testsplit9() { assertEval("argv <- list(structure(c(NA, NA), .Dim = 1:2), structure(1:2, .Label = c(\'1\', \'2\'), class = \'factor\')); .Internal(split(argv[[1]], argv[[2]]))"); } @@ -85,7 +83,6 @@ public class TestrGenBuiltinsplit extends TestBase { } @Test - @Ignore public void testsplit15() { assertEval("argv <- list(character(0), structure(integer(0), .Label = character(0), class = \'factor\')); .Internal(split(argv[[1]], argv[[2]]))"); } @@ -113,5 +110,4 @@ public class TestrGenBuiltinsplit extends TestBase { public void testsplit19() { assertEval("argv <- list(c(1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 26.3011774151224, 2.485452029809, 7.15323925419351, 16.761819986295, 10.2645644917686, 0.758337657329402, 29.4935619829433, 12.665970880074, 2.27782676164194e-08, 0.115876279686418), structure(c(1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 1L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 2L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 3L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 4L, 5L, 5L, 5L, 5L, 5L, 5L, 5L, 5L, 5L, 5L, 5L, 5L, 5L, 5L, 5L, 5L, 5L, 5L, 5L, 5L, 5L, 5L, 5L, 5L, 5L, 6L, 6L, 6L, 6L, 6L, 6L, 6L, 6L, 6L, 6L, 6L, 6L, 6L, 6L, 6L, 6L, 6L, 6L, 6L, 6L, 6L, 6L, 6L, 6L, 6L, 6L, 6L, 6L, 6L, 6L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 7L, 8L, 8L, 8L, 8L, 8L, 8L, 8L, 9L, 9L, 9L, 9L, 9L, 9L, 9L, 9L, 9L, 9L, 9L, 9L, 10L, 10L, 10L, 10L, 10L, 10L, 10L, 10L, 10L, 10L, 10L, 10L, 10L, 10L, 10L, 10L, 10L, 10L, 10L, 11L, 11L, 11L, 11L, 11L, 11L, 11L, 11L, 11L, 11L, 11L, 11L, 11L, 11L, 11L, 12L, 13L, 14L, 15L, 16L, 17L, 18L, 19L, 20L, 21L), .Label = c(\'1\', \'3\', \'5\', \'7\', \'9\', \'11\', \'13\', \'15\', \'17\', \'19\', \'21\', \'23\', \'25\', \'27\', \'29\', \'31\', \'33\', \'35\', \'37\', \'39\', \'41\'), class = \'factor\')); .Internal(split(argv[[1]], argv[[2]]))"); } - } diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinsprintf.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinsprintf.java index ff356259e6..4711958465 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinsprintf.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinsprintf.java @@ -2,9 +2,9 @@ * This material is distributed under the GNU General Public License * Version 2. You may review the terms of this license at * http://www.gnu.org/licenses/gpl-2.0.html - * + * * Copyright (c) 2014, Purdue University - * Copyright (c) 2014, Oracle and/or its affiliates + * Copyright (c) 2014, 2015, Oracle and/or its affiliates * * All rights reserved. */ @@ -18,7 +18,6 @@ import com.oracle.truffle.r.test.*; public class TestrGenBuiltinsprintf extends TestBase { @Test - @Ignore public void testsprintf1() { assertEval("argv <- list(\'%s is not TRUE\', \'identical(fxy, c(1, 2, 3))\'); .Internal(sprintf(argv[[1]], argv[[2]]))"); } @@ -36,19 +35,16 @@ public class TestrGenBuiltinsprintf extends TestBase { } @Test - @Ignore public void testsprintf4() { assertEval("argv <- list(\'%o\', integer(0)); .Internal(sprintf(argv[[1]], argv[[2]]))"); } @Test - @Ignore public void testsprintf5() { assertEval("argv <- list(\'%*s\', 1, \'\'); .Internal(sprintf(argv[[1]], argv[[2]], argv[[3]]))"); } @Test - @Ignore public void testsprintf6() { assertEval("argv <- list(\'p,L,S = (%2d,%2d,%2d): \', TRUE, TRUE, FALSE); .Internal(sprintf(argv[[1]], argv[[2]], argv[[3]], argv[[4]]))"); } @@ -78,43 +74,36 @@ public class TestrGenBuiltinsprintf extends TestBase { } @Test - @Ignore public void testsprintf11() { assertEval("argv <- list(\'%1$d %1$x %1$X\', 0:15); .Internal(sprintf(argv[[1]], argv[[2]]))"); } @Test - @Ignore public void testsprintf12() { assertEval("argv <- list(\'%03o\', 1:255); .Internal(sprintf(argv[[1]], argv[[2]]))"); } @Test - @Ignore public void testsprintf13() { assertEval("argv <- list(\'%d y value <= 0 omitted from logarithmic plot\', 1L); .Internal(sprintf(argv[[1]], argv[[2]]))"); } @Test - @Ignore public void testsprintf14() { assertEval("argv <- list(\'%o\', 1:255); .Internal(sprintf(argv[[1]], argv[[2]]))"); } @Test - @Ignore public void testsprintf15() { assertEval("argv <- list(\'%s-class.Rd\', structure(\'foo\', .Names = \'foo\')); .Internal(sprintf(argv[[1]], argv[[2]]))"); } @Test - @Ignore public void testsprintf16() { assertEval("argv <- list(\'checkRd: (%d) %s\', -3, \'evalSource.Rd:157: Unnecessary braces at ‘{\\\'sourceEnvironment\\\'}’\'); .Internal(sprintf(argv[[1]], argv[[2]], argv[[3]]))"); } @Test - @Ignore public void testsprintf17() { assertEval("argv <- list(\'tools:::check_compiled_code(\\\'%s\\\')\', \'/home/lzhao/hg/r-instrumented/library/foreign\'); .Internal(sprintf(argv[[1]], argv[[2]]))"); } @@ -126,16 +115,12 @@ public class TestrGenBuiltinsprintf extends TestBase { } @Test - @Ignore public void testsprintf19() { assertEval("argv <- list(\'%G\', 3.14159265358979e-06); .Internal(sprintf(argv[[1]], argv[[2]]))"); } - @Test - public void testsprintf21() { - assertEval("argv <- structure(list(fmt = \'%9.4g\', 12345.6789), .Names = c(\'fmt\', \'\'));"+ - "do.call(\'sprintf\', argv)"); - } - + @Test + public void testsprintf21() { + assertEval("argv <- structure(list(fmt = \'%9.4g\', 12345.6789), .Names = c(\'fmt\', \'\'));" + "do.call(\'sprintf\', argv)"); + } } - diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinstrsplit.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinstrsplit.java index eaee5a906b..2cf41fdbf7 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinstrsplit.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinstrsplit.java @@ -74,7 +74,6 @@ public class TestrGenBuiltinstrsplit extends TestBase { } @Test - @Ignore public void teststrsplit11() { assertEval("argv <- list(structure(\'pkgB\', .Names = \'name\'), \'_\', TRUE, FALSE, FALSE); .Internal(strsplit(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]]))"); } diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinsub.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinsub.java index 0a312d2043..c97d99c754 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinsub.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinsub.java @@ -2,9 +2,9 @@ * This material is distributed under the GNU General Public License * Version 2. You may review the terms of this license at * http://www.gnu.org/licenses/gpl-2.0.html - * + * * Copyright (c) 2014, Purdue University - * Copyright (c) 2014, Oracle and/or its affiliates + * Copyright (c) 2014, 2015, Oracle and/or its affiliates * * All rights reserved. */ @@ -70,7 +70,6 @@ public class TestrGenBuiltinsub extends TestBase { } @Test - @Ignore public void testsub10() { assertEval("argv <- list(\'^[[:space:]]*([[:alnum:].]+).*$\', \'\\\\1\', structure(\'MASS\', .Names = \'Suggests\'), FALSE, FALSE, FALSE, FALSE); .Internal(sub(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]]))"); } @@ -110,7 +109,6 @@ public class TestrGenBuiltinsub extends TestBase { } @Test - @Ignore public void testsub17() { assertEval("argv <- list(\'^msgstr[[:blank:]]+[\\\'](.*)[\\\'][[:blank:]]*$\', \'\\\\1\', \'msgstr \\\'<U+043E><U+0442><U+0440><U+0438><U+0446><U+0430><U+0442><U+0435><U+043B><U+044C><U+043D><U+044B><U+0435> <U+0432><U+0435><U+0441><U+0430> <U+043D><U+0435> <U+0440><U+0430><U+0437><U+0440><U+0435><U+0448><U+0435><U+043D><U+044B>\\\'\', FALSE, FALSE, FALSE, FALSE); .Internal(sub(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]]))"); } @@ -126,4 +124,3 @@ public class TestrGenBuiltinsub extends TestBase { assertEval("argv <- list(\'([^:]*):(.*)\', \'\\\\2\', character(0), FALSE, FALSE, FALSE, FALSE); .Internal(sub(argv[[1]], argv[[2]], argv[[3]], argv[[4]], argv[[5]], argv[[6]], argv[[7]]))"); } } - diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinunique.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinunique.java index cb83c01de8..71d42b9dd5 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinunique.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinunique.java @@ -50,7 +50,6 @@ public class TestrGenBuiltinunique extends TestBase { } @Test - @Ignore public void testunique7() { assertEval("argv <- list(structure(list(a = 1), .Names = \'a\'), FALSE, FALSE, NA); .Internal(unique(argv[[1]], argv[[2]], argv[[3]], argv[[4]]))"); } @@ -61,7 +60,6 @@ public class TestrGenBuiltinunique extends TestBase { } @Test - @Ignore public void testunique9() { assertEval("argv <- list(list(FALSE), FALSE, FALSE, NA); .Internal(unique(argv[[1]], argv[[2]], argv[[3]], argv[[4]]))"); } diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinunitsassign_.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinunitsassign_.java index a3af42129f..b5eaaa9f98 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinunitsassign_.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinunitsassign_.java @@ -2,9 +2,9 @@ * This material is distributed under the GNU General Public License * Version 2. You may review the terms of this license at * http://www.gnu.org/licenses/gpl-2.0.html - * + * * Copyright (c) 2014, Purdue University - * Copyright (c) 2014, Oracle and/or its affiliates + * Copyright (c) 2014, 2015, Oracle and/or its affiliates * All rights reserved. */ package com.oracle.truffle.r.test.testrgen; @@ -15,14 +15,11 @@ import com.oracle.truffle.r.test.*; // Checkstyle: stop line length check - public class TestrGenBuiltinunitsassign_ extends TestBase { - - @Test - @Ignore - public void testunitsassign_1() { - assertEval("argv <- structure(list(x = structure(500, units = \'secs\', class = \'difftime\', .Names = \'a\'), value = \'mins\'), .Names = c(\'x\', \'value\'));"+ - "do.call(\'units<-\', argv)"); - } +public class TestrGenBuiltinunitsassign_ extends TestBase { + @Test + public void testunitsassign_1() { + assertEval("argv <- structure(list(x = structure(500, units = \'secs\', class = \'difftime\', .Names = \'a\'), value = \'mins\'), .Names = c(\'x\', \'value\'));" + + "do.call(\'units<-\', argv)"); + } } - diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinunitsassign_difftime.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinunitsassign_difftime.java index 9b58858d9a..062ebf2d49 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinunitsassign_difftime.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinunitsassign_difftime.java @@ -2,9 +2,9 @@ * This material is distributed under the GNU General Public License * Version 2. You may review the terms of this license at * http://www.gnu.org/licenses/gpl-2.0.html - * + * * Copyright (c) 2014, Purdue University - * Copyright (c) 2014, Oracle and/or its affiliates + * Copyright (c) 2014, 2015, Oracle and/or its affiliates * All rights reserved. */ package com.oracle.truffle.r.test.testrgen; @@ -15,14 +15,11 @@ import com.oracle.truffle.r.test.*; // Checkstyle: stop line length check - public class TestrGenBuiltinunitsassign_difftime extends TestBase { - - @Test - @Ignore - public void testunitsassign_difftime1() { - assertEval("argv <- structure(list(x = structure(500, units = \'secs\', class = \'difftime\', .Names = \'a\'), value = \'mins\'), .Names = c(\'x\', \'value\'));"+ - "do.call(\'units<-.difftime\', argv)"); - } +public class TestrGenBuiltinunitsassign_difftime extends TestBase { + @Test + public void testunitsassign_difftime1() { + assertEval("argv <- structure(list(x = structure(500, units = \'secs\', class = \'difftime\', .Names = \'a\'), value = \'mins\'), .Names = c(\'x\', \'value\'));" + + "do.call(\'units<-.difftime\', argv)"); + } } - diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinvector.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinvector.java index 772167b2a0..99ac952081 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinvector.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinvector.java @@ -2,9 +2,9 @@ * This material is distributed under the GNU General Public License * Version 2. You may review the terms of this license at * http://www.gnu.org/licenses/gpl-2.0.html - * + * * Copyright (c) 2014, Purdue University - * Copyright (c) 2014, Oracle and/or its affiliates + * Copyright (c) 2014, 2015, Oracle and/or its affiliates * * All rights reserved. */ @@ -43,7 +43,6 @@ public class TestrGenBuiltinvector extends TestBase { } @Test - @Ignore public void testvector9() { assertEval("argv <- list(\'raw\', 0L); .Internal(vector(argv[[1]], argv[[2]]))"); } @@ -54,12 +53,9 @@ public class TestrGenBuiltinvector extends TestBase { assertEval("argv <- list(\'list\', structure(1L, .Names = \'\\\\c\')); .Internal(vector(argv[[1]], argv[[2]]))"); } - @Test + @Test @Ignore - public void testvector11() { - assertEval("argv <- structure(list(mode = \'complex\', length = 7), .Names = c(\'mode\', \'length\'));"+ - "do.call(\'vector\', argv)"); - } - + public void testvector11() { + assertEval("argv <- structure(list(mode = \'complex\', length = 7), .Names = c(\'mode\', \'length\'));" + "do.call(\'vector\', argv)"); + } } - diff --git a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinwriteLines.java b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinwriteLines.java index aee7dae395..beab5cba33 100644 --- a/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinwriteLines.java +++ b/com.oracle.truffle.r.test/src/com/oracle/truffle/r/test/testrgen/TestrGenBuiltinwriteLines.java @@ -2,9 +2,9 @@ * This material is distributed under the GNU General Public License * Version 2. You may review the terms of this license at * http://www.gnu.org/licenses/gpl-2.0.html - * + * * Copyright (c) 2014, Purdue University - * Copyright (c) 2014, Oracle and/or its affiliates + * Copyright (c) 2014, 2015, Oracle and/or its affiliates * All rights reserved. */ package com.oracle.truffle.r.test.testrgen; @@ -15,14 +15,11 @@ import com.oracle.truffle.r.test.*; // Checkstyle: stop line length check - public class TestrGenBuiltinwriteLines extends TestBase { - - @Test - @Ignore - public void testwriteLines1() { - assertEval("argv <- structure(list(text = \' \\' A \\'; \\'B\\' ;\\'C\\';\\' D \\';\\'E \\'; F ;G \', con = \'foo\'), .Names = c(\'text\', \'con\'));"+ - "do.call(\'writeLines\', argv)"); - } +public class TestrGenBuiltinwriteLines extends TestBase { + @Test + public void testwriteLines1() { + assertEval("argv <- structure(list(text = \' \\' A \\'; \\'B\\' ;\\'C\\';\\' D \\';\\'E \\'; F ;G \', con = \'foo\'), .Names = c(\'text\', \'con\'));" + + "do.call(\'writeLines\', argv)"); + } } - -- GitLab